KEGG   Sulfobacillus acidophilus TPY: TPY_2940Help
Entry
TPY_2940          CDS       T01576                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPY_2940 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPY_2940 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TPY_2940 (thrC)
Enzymes [BR:say01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TPY_2940 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2721150..2722199
Genome map
AA seq 349 aa AA seqDB search
MSGVIQRYRKYLDLPDLEPVSLGEGSTPLIPWSQWHNTRVWLKLEGMNPTGSFKDRGMTV
AVSIARHEGAKAVICASTGNTAASAAAYAGRAGLSALVVVPQGQVTREKMLQASAYGATL
LAVEGNFDAALALVRRTADENPAIALVNSVNPWRLRGQETGAYEVVDSLGHAPAALVIPV
GNAGNISAYFQGFRRYGRGIPQMMGIQAEGASPLVKGEFFEHPQTVASAIRIGKPASAHL
AREAVAESRGRFFAVSDALILAAQKELARGGVYVEPASATAYAGLKQLFEMGAIPAGDVV
AVLTGSGLKDGTTPLQWVDAEPVVTTADTILSTINQLLSKKEQDAHVAH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgtgatccaacgctaccgcaaatatctcgatttaccggatctggaacccgtg
tccttaggtgaaggctctacgcccttaattccctggagccagtggcataacacccgggtc
tggcttaagttggaagggatgaatcccaccggatcgttcaaagaccgaggtatgacggtg
gccgtcagtattgcacgccatgaaggcgccaaagccgtcatttgtgcctccaccggtaat
acggcggcatccgccgccgcttatgccggacgggcgggattatccgcgttggtggtcgta
ccccaaggccaagtcacccgagaaaaaatgttgcaagccagtgcctatggtgccacgttg
ttggctgtcgaaggtaatttcgatgccgcgctggccctcgtccgacggaccgcggacgaa
aacccggcgattgccttggtcaattccgtcaacccctggcggcttcgggggcaagaaacg
ggagcctacgaagtcgtcgacagcttgggtcatgcgccggccgcgttagtgattccggtc
ggcaatgccggtaacatttcggcttactttcaagggtttcgccgctacgggcggggaatt
ccgcagatgatgggcattcaggccgaaggggctagcccgctggtaaaaggcgaatttttc
gaacacccgcaaacggtcgcgtcggccatccggattggtaaaccggccagtgcccatctg
gcccgagaagccgtggccgagtcccgagggcgatttttcgccgtcagcgatgccctcatt
ctggccgcccaaaaggaattggcccgcggcggagtgtacgttgagccggcctccgcgacc
gcgtacgccgggttaaagcagttattcgagatgggagcgatcccggcgggggacgtggtg
gccgttttaaccgggtcgggcctcaaagacggtaccacccctcttcagtgggtcgatgcc
gaaccggtggtcaccactgccgatacgattttatccacgattaatcagctgttgtccaaa
aaggagcaggacgcccatgtggcacattaa

DBGET integrated database retrieval system