KEGG   Sulfobacillus acidophilus TPY: TPY_2949Help
Entry
TPY_2949          CDS       T01576                                 

Gene name
fdhA
Definition
(GenBank) hypothetical protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00625  Chloroalkane and chloroalkene degradation
say00680  Methane metabolism
say01100  Metabolic pathways
say01120  Microbial metabolism in diverse environments
say01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    TPY_2949 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TPY_2949 (fdhA)
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     TPY_2949 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N HI0933_like AlaDh_PNT_C Glu_dehyd_C TrkA_N Pyr_redox Pyr_redox_2 FAD_oxidored FAD_binding_2 DAO Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEJ41107
UniProt: F8I669
Position
2731348..2732481
Genome map
AA seq 377 aa AA seqDB search
MKAVVYQGPFQVAVQEVPEPTIQHPADVIVKITTSCICGSDLHMYEGRTAAEPGIIFGHE
NMGVVVETGSAVSRLKVGDRVVMPFNIGCGHCQNCESGYTAFCTEVNPGFAGGAYGYVAM
GPYPGGQAQYLRVPWADFNALSLPPGREHESDFALLADIFPTGWHGVSLSGFQPGESLVV
FGGGPVGLMAAYSAVLRGASEVYVVDRVPERLEKARQIGTIPINFDQADAVDQILDQRHG
AYVDRAVDAVGYQATQAGREVPNTVLVSMVRVVRATGGLGVPGLYVPSDPGGVDPLAREG
YLSFPVGKFFEKGLKMGTGQCNVKQYNRYLRDLIIAGRATPSFVVSHEISLEDAPLAYEK
FDKRIEGYTKVLIHPND
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgtctaccaagggccgtttcaagtagccgtccaagaggttcctgaaccc
acgattcagcatccggcagatgtgatcgtcaaaatcaccacctcctgtatttgcgggtcg
gatttgcacatgtacgaggggcgtacggccgccgagccgggcatcatttttggtcacgaa
aatatgggcgtggtggtcgaaaccggatccgcggtaagtcggttaaaagtcggcgatcgg
gtcgtcatgcccttcaatatcggctgcggccattgccaaaattgtgaatccggttatacg
gccttttgcactgaggtgaatcccggttttgccgggggcgcctacggttatgtcgccatg
ggcccctatcccggcgggcaagcccaatatctacgggtgccctgggctgattttaatgcg
ctcagtctgccccccggccgcgaacacgaatcggacttcgcgttgttggccgatattttc
cccaccgggtggcacggtgtcagtttgtccggattccaacccggcgaatccctggttgtt
ttcggcggcgggccggtcggcttaatggcagcgtatagcgccgtgctccggggcgcctcc
gaagtgtatgttgtcgaccgcgttcccgaacggctggaaaaagctcgtcaaatcggtacg
atcccgattaactttgatcaagcggatgccgtcgaccagattttagatcagaggcatggc
gcctacgtggatcgagcggttgacgccgtaggatatcaggccacgcaagccggccgcgaa
gtgcctaacacggttctcgtctccatggttcgtgtagtacgggcgaccggagggctcggg
gtgcccggcctttatgtgccctcggaccctggaggtgtggacccgttggcacgggaagga
tatctttcgtttcctgtcggcaagtttttcgaaaaaggtctcaagatgggcaccggacaa
tgcaatgtcaagcaatataaccgttatttacgggacttaatcatcgccgggcgagccacc
ccaagcttcgtcgtctctcatgaaatttccctcgaggatgcccctctggcctatgaaaag
tttgataaacggattgaggggtacaccaaagtcttgattcatccgaacgattaa

DBGET integrated database retrieval system