KEGG   Sulfobacillus acidophilus TPY: TPY_2954Help
Entry
TPY_2954          CDS       T01576                                 

Gene name
glpK
Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:say00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2735751..2737259)
Genome map
AA seq 502 aa AA seqDB search
MSRMSGRYILALDQGTTSSRAILFNQQALPVAIGQREFRQIYPEPGWVEHDPEEIWASQW
EAIEECLQKAEATPDDILAIGITNQRETTILWDHATGRPVYNAIVWQCRRTADFAASLRD
RGLSPMVQEKTGLVIDAYFSGTKVAWLLDHVPGLRERAEAGEIKFGTVDSWLIYKLTGGA
RHVTDYSNASRTLMFNIHDLAWDLELLSLLNIPAAVCPEVVDSSGIVGYTDPRWFGRPIP
IAGIAGDQQAALFGQGCYDPGMAKNTYGTGSFMLMNTGTEPVTSRHGLVTTIAWSINGTV
SYALEGSIFVAGAVVQWLRDELGVIQDAAETEALAASVPDTGDVYFVPAFVGLGAPIWDS
YARGLIIGLTRGTKKAHLVRAALESMAYQTRDVLEVMVKDSGFPVTTLRVDGGAIRNQFL
AQFQADIVGCRVDRPRVTETTALGAAFLAGLAVGFWPDLSTIQQTWQKDASFEPQMDPAT
REARYQRWQAAVDRARGWVGHE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggatgagtggtcgatatattttggccttagatcagggaaccacgagttctcgt
gccattttattcaatcagcaggcgttgccggtggccattgggcaacgggagtttcgtcaa
atctatccggaacccggctgggtggaacatgatccggaagaaatttgggcgtcgcaatgg
gaagccattgaagagtgtctccaaaaggcagaagcaacgccggacgacattttggccatc
gggattaccaaccagcgtgagacgacgattctctgggatcacgccaccggccggccggta
tacaacgccattgtttggcaatgtcggcgcacggcggatttcgctgcatccttacgggac
cgcggtttaagccccatggttcaagagaaaaccgggcttgtaatcgacgcgtacttttcc
ggcaccaaagtggcttggctattggatcatgtgccgggcctgcgggagcgggccgaggcc
ggtgagattaaattcgggacggttgacagttggcttatctacaaattgacggggggagca
cggcacgtcaccgattattccaatgcctcgcggacactgatgtttaacattcacgacttg
gcctgggacctggaactcctgtcattattgaatattccggccgccgtgtgccccgaggtg
gtggattcctccggtattgtcgggtacaccgatccccggtggtttggacggccgattccg
attgctggcattgccggggatcagcaggccgcgttattcgggcaagggtgttatgacccg
ggaatggccaagaacacgtacgggaccggatcgttcatgctgatgaacacaggcaccgag
ccggtgacgtcccggcatgggctggtgacgaccattgcctggagcattaacggaacggtc
tcctatgccttggagggctcgatctttgtcgccggagccgtggtccaatggctgcgggac
gaattgggggtgattcaagacgcggcggaaaccgaggctttggccgcatccgtgcccgac
accggcgatgtctactttgttccggcttttgtcggattgggcgcacccatctgggacagt
tatgctcgagggttgattatcggcctgacccgcgggacaaaaaaagcgcatctggttcgg
gcggcactggagtcgatggcgtaccagacgcgtgacgtgctcgaagtcatggtcaaggac
agcggatttccggtgacgaccctgcgggtggacggaggagccatccggaatcaattcttg
gcccagtttcaagccgatattgtcgggtgccgggttgatcggccgcgggttacggaaacg
acggccttaggggcggcgtttttggccgggttagccgtcgggttttggccggatctatcg
actatccaacaaacgtggcaaaaagacgccagctttgagccccaaatggatcccgccaca
cgggaagcgcgctaccaacgatggcaagccgcggtcgaccgcgcgcgcgggtgggtcggc
cacgaataa

DBGET integrated database retrieval system