KEGG   Sulfobacillus acidophilus TPY: TPY_2997Help
Entry
TPY_2997          CDS       T01576                                 

Gene name
acs
Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:say01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:say00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:say00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:say00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:say00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2784023..2785585)
Genome map
AA seq 520 aa AA seqDB search
MMDERWLQDIHRLKTRYQTDPVNAAWYLVGNKDPHKPALYYHRPDQSAVTFTYDELRRES
AKWAARLAAQGVRSKDRVAGLLPKRPELAAMILGAWRLGAVYVPLFTAFGSDAVRYRIEQ
SRAKVVVTDDTHREKVAGMRDVVVFNVDHPDQDPESLDVWQALSENDLLVLLFTSGTTGH
PKGVPVPIRALPAFEAYMRWGLDVRPSDRFWNLADPGWAYGLYYGLIGPWLVDQAIFWYG
GSFDPDRVMALIKEAGITNFAAAPTAYRAMRAQGAVLPDTLRAISSAGEPLNPEVIRWAE
TALGLPILDHYGQTELGMVINNHQVPELQRPLKWGSMGHPMPGFRAVVLDDDGHEVPPKT
EGHIALDIGQSPLFWFPGYEGSDSATQSRLTADGRYYLTGDDGSVDEEGYFFFTGRSDDV
ILSAGYRIGPFEVESTLMAHPAVAECAVVGVPDALRGEAIRAYVVLRPGFVTNAQLEDEL
KDWVRQRLAKTHYPREIRLVDTLPKTPSGKIQRFILRQSE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgaaagatggcttcaagacattcatcggttaaaaacccggtatcaaacggat
ccggtgaatgcggcctggtatttggtcggaaacaaagatccgcacaagccggcgctctac
taccatcggccggatcagtcggcggtgacctttacgtatgacgagctgaggcgggagtcg
gcgaaatgggcggcacggttggccgcgcagggggtccgttcgaaagaccgcgtcgccggt
cttttgccgaaacggccggagttggccgccatgatattaggcgcctggcgcttgggtgcg
gtctatgttccgctttttaccgccttcggttcggacgcggtccggtatcgcatcgagcaa
agccgggcgaaagtcgtcgtaacggacgatacccatcgggaaaaagtggcggggatgcgg
gacgtggtcgtattcaatgtcgatcacccggatcaagatcccgaaagccttgacgtatgg
caggccctctcggagaacgatctcttggtcttgctctttacctcggggaccacggggcat
cccaagggggtaccggtgcccatacgagccctgccggcatttgaagcgtatatgcggtgg
ggattggatgtgcggccgagtgaccggttttggaatctggcggatcccggctgggcctat
ggcctctattatggcttgattgggccctggctggttgaccaggcgatcttttggtacggc
ggatcgtttgacccggaccgggttatggctctcataaaggaggcggggattaccaatttt
gccgcggcgccgaccgcctatcgggccatgcgggctcaaggggcggtgcttcccgacact
ttgcgggcgatttccagtgccggtgaaccgttaaatccggaagtcatccgctgggccgaa
accgccctcggccttccgattttggatcattacggacaaaccgagctgggtatggtgatt
aataaccaccaagttccagagcttcaacgccctctcaaatgggggtccatggggcacccc
atgcccgggtttcgcgcggtggtccttgacgacgacgggcatgaagtgccgccgaaaacc
gaagggcatatcgcgctcgatatcgggcaatcgcccttgttttggtttcccgggtatgaa
gggtccgattcggcgacccagtcccgtttgaccgcggatggccgctattatctcaccgga
gatgacgggagtgttgacgaagaaggctatttctttttcaccgggcgttccgacgatgtg
attttaagcgcagggtatcggattggcccttttgaggtggaaagcaccttaatggcgcat
ccggccgtcgccgaatgcgcggtggtgggggtgcccgatgcattacggggggaggccatt
cgcgcctacgtggtactgaggccgggtttcgtgacgaatgcacaattggaagacgaatta
aaagattgggttcgtcaacggctcgccaagactcattatccccgtgaaattcggctggtg
gataccttgcctaaaacccccagcgggaaaattcaacgatttatcttgcgtcaaagcgaa
taa

DBGET integrated database retrieval system