KEGG   Sulfobacillus acidophilus TPY: TPY_3036Help
Entry
TPY_3036          CDS       T01576                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00330  Arginine and proline metabolism
say00332  Carbapenem biosynthesis
say01100  Metabolic pathways
say01130  Biosynthesis of antibiotics
say01230  Biosynthesis of amino acids
Module
say_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TPY_3036 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TPY_3036 (proB)
Enzymes [BR:say01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TPY_3036 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AEJ41194
UniProt: F8I6W7
Position
complement(2823059..2823760)
Genome map
AA seq 233 aa AA seqDB search
MFTRQIKALHERGHQVVVVTSGAIGTGMGTTKIRPKTLSERQALAAIGQAHLMEYYRKAL
APITMGQLLLTYPDISDPIRRDIFCQTLEHMLQWRTIPVVNENDAVTDDESRIGDNDTLA
AHLAVMVRANRLVILTDIDGLYTDNPYQNPGAQRIDALPWVTLEHVEQFGAGEPGQFGAG
GMATKLQAARIAQEAGIEMVLASSREPGVLQKIDAPNWQGGTRFLARRGVSHA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccgtcagatcaaggcgctgcatgagcgggggcaccaagtggtggtcgtgacc
tcaggcgcgattgggacggggatggggaccaccaaaatccgtcctaagacgctgtctgag
cgccaagccctggcggccattggacaggcgcacctcatggaatattaccgtaaagcgttg
gctcccattacgatggggcagctgcttttgacctatcccgatattagcgatccgattcgg
cgtgacatattttgccaaacattggaacacatgttgcagtggcggaccatcccggtcgtc
aacgaaaatgatgcggtgaccgacgacgagtcgcgcattggcgacaatgatacgttggcg
gctcatctagccgtgatggtccgggccaatcgtttggttatcttgacggatattgacgga
ctttataccgataacccttatcaaaatccgggtgcgcaacgcatcgacgccttaccttgg
gttaccctagagcacgtggaacagttcggggccggcgaaccgggacaatttggggccggc
ggcatggccacgaagctgcaggccgcccgtatcgcgcaggaagccgggatcgagatggtt
ctcgcgtcaagccgcgagcccggggttttgcaaaagattgatgccccgaattggcaaggg
ggcacgcggtttttggcacggaggggggtctcccatgcttaa

DBGET integrated database retrieval system