KEGG   Sulfobacillus acidophilus TPY: TPY_3050Help
Entry
TPY_3050          CDS       T01576                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00860  Porphyrin and chlorophyll metabolism
say01100  Metabolic pathways
say01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TPY_3050
Enzymes [BR:say01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TPY_3050
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     TPY_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 Pyr_redox FMO-like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AEJ41208
UniProt: F8I6Y1
Position
complement(2836443..2837513)
Genome map
AA seq 356 aa AA seqDB search
MKQVAIVGGGISGLSVAYALEALLVPELSDIVLFEASSELGGVIQSDMWQGQVLEGGPDT
LTDRPFGVLDLVHAIGLAHRLIGVRPGAQGTLVYGSDGWLKFSGQEARAYTLAGGLAELP
HAVASHLMRTRILRQARVQKLSWDTRGRVRVWWERGVLTADAVILAVPAPIAADLMRPLD
PDRARRLEQILYQPRAVVTAVYPSHAFVDVRVYTHTGFMTIKGAPLACSGASWMTTKWNY
PGARDHVVLRTFWGPPGVDPSPWSDRELIDRHEHDLTRALGPHQPPEFVRVFRHPYAVPQ
VPSGWTDSQPRVPYSSYIGMVGPFFAGAGLSDCVHRAWQEASRVTEWMTASGTGIG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggtggccattgtgggcgggggcatctctggactgagtgtggcgtacgctcta
gaggcgctattagtgccggaattgtccgatattgttttgttcgaggcgtcgtccgaactg
ggcggcgtcattcaaagcgacatgtggcaaggtcaggtgctggagggcggacccgatacc
ttaacggatcggccttttggcgtgctcgacttagtgcatgcgatcggattggctcatcgc
ttaattggggtgcgtcccggtgcgcaaggcacattggtctatggctccgacggctggctg
aaattttccggacaagaagcccgggcgtatacgttggccgggggattggcggaattgccg
cacgcggtcgcatcgcatctaatgcggacccgtattttacggcaagcgcgggtgcaaaag
ttgtcttgggacacccggggacgcgttcgggtatggtgggagcgcggtgttttaaccgcc
gatgccgtcattttggccgtgccggcgccgattgcggccgatttgatgcggccgttagac
ccggaccgggcccgacgtctcgaacaaattctctatcagccgcgggcggtggtcaccgct
gtatatccttctcatgcattcgtcgatgtacgggtatacacccataccggctttatgacc
attaaaggggcgccgttggcctgctccggggcgtcttggatgacaaccaaatggaactat
cctggggcccgtgaccatgtggtattacggacgttctggggaccaccgggggtagatccc
tcgccctggtctgatcgcgaattgatcgaccggcatgaacacgatttaacccgggcgtta
ggcccccatcaaccgcccgaatttgtgcgggttttccgccatccctatgccgtaccgcag
gtaccgagcggctggacggacagtcagccgcgggttccctattcgagttatatcggcatg
gtagggccttttttcgccggagcgggtttgtcggattgtgtccaccgggcctggcaagag
gcaagccgggtgacggagtggatgacggcgtcgggaacggggattggatag

DBGET integrated database retrieval system