KEGG   Sulfobacillus acidophilus TPY: TPY_3234Help
Entry
TPY_3234          CDS       T01576                                 

Gene name
cysQ
Definition
3'-phosphadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:say00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2989280..2990062)
Genome map
AA seq 260 aa AA seqDB search
MNPTDWANRLEPALAAAERLILAVYERAEIPRRLKADQSPVTEADHGSSQILVEALRRLT
PEIPVISEEAEWSGESVPRFWVIDPLDGTKEFIAHRGEFTMNLALIDGGKPVWGLIAVPL
SGRRYVAWDRQAYRVEPDGSWHRLNPLMPPHNGLRVAASHSHPELVRAWCREQAVPIREL
REAGSALKFVWMAEGEIDIYPRLKPTMAWDTAAGQVLVESLGGHVLRWPLGTSLTYYSDQ
MVNPSFVASTPGVPVKFVGN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccacggattgggctaatcggctggagccggctctggccgcagccgaacggttg
attctggccgtctatgaaagggcggagataccccgccggttgaaagccgaccaatcgccg
gttacggaagccgatcacgggtccagccagattctggtcgaggctttacggcggttaaca
cccgagatcccggtgatttcggaggaagccgaatggtcaggggaatccgtgccgcggttt
tgggtcatcgatccgctggacgggacgaaagaatttatcgcccatcgcggcgaatttacg
atgaatctcgccttgatcgacggcggcaaaccggtgtggggcctgattgccgtgcccctt
agcggccgccgctatgtggcttgggatcggcaagcctatcgggtggagccggacgggtct
tggcaccggctcaacccgttaatgcctccgcacaacggacttcgggtggcggccagtcat
agccatccggagttggtccgggcctggtgtcgagagcaggcggtcccgatacgggaattg
cgagaagccgggagtgccttaaagttcgtgtggatggccgaaggcgaaattgatatttat
ccccggctgaaacccaccatggcttgggatacggccgccggtcaagttctggtggaaagc
ctcggaggccacgttctgcgttggccgttaggcacctcgttgacctattattcggatcag
atggttaacccgtcatttgtggccagtactcctggcgtccccgtgaagtttgtgggaaat
taa

DBGET integrated database retrieval system