KEGG   Sulfobacillus acidophilus TPY: TPY_3448Help
Entry
TPY_3448          CDS       T01576                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00240  Pyrimidine metabolism
say00250  Alanine, aspartate and glutamate metabolism
say01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:say00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TPY_3448 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TPY_3448 (pyrB)
Enzymes [BR:say01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TPY_3448 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEJ41600
UniProt: F8IAC2
Position
complement(3192082..3192999)
Genome map
AA seq 305 aa AA seqDB search
MGHLIGIQAYSTGELQEILDQAQSFYRQLTQKPRQIPPALHGRTVVTWFMEPSTRTRASF
ELAARYLGAEVLSLATEGSSMVKGETLWDTLANLEAMGIDALVVRHAEAGVPWQLARRAR
VPVINAGDGWHEHPTQALLDLLTVRQALGDVSGLHVAIVGDILHSRVARSDIWGFTRMGA
TVTLVGPPQFVPSEWPAKGVRVSDELSEVLPSADVVILLRIQKERQALNGLFSVEEYRLR
WGLTAERFRILKPGAVVLHPGPQNRGVEIDSDVMAQDSVLIGRQVTNGVAVRMAVLSRLM
GEKTW
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggcatcttatcgggatccaggcctattcgacgggggaattacaagagattttggat
caggcccaatccttctatcgccaacttacgcaaaagcctcgacaaatccccccggcgctg
cacggtcggacggtcgtgacctggtttatggagccgagcacgcgcacacgtgcgtctttt
gagctggcggcgcgctacttgggggcggaggtcctatccctggcgaccgaagggtcgagt
atggttaaaggcgaaacgctatgggacacgctggccaatttggaggccatgggtatcgat
gcgttggtggtgcgccatgcagaagcgggcgtcccctggcaactggcccgaagggcgcgg
gttcccgtgattaatgccggagacggctggcatgaacacccgacgcaggcgctcttggat
ttgttaacggttcggcaggcattgggggatgtctcgggtcttcacgtcgcgattgtgggt
gacattttgcacagccgggtcgcccgttcggatatttggggatttactcggatgggggcc
acggtgacattggtggggccgccgcaatttgttccgtccgaatggccagccaagggagtc
cgggtttcggacgagctctcggaagtcttgccttcggcggacgtggtaattttattaagg
attcaaaaagagcgacaggccctcaacggcctcttttcggtggaagagtatcgcttgcgg
tgggggctgactgctgagcggtttcggatattgaaacccggggcggtggtgctccatccg
ggtccgcaaaatcgcggggtggagatcgatagtgacgtcatggcgcaagactcggttctg
attggacgccaagtgaccaatggggtagcggtccgcatggccgtattgtcccggctgatg
ggggaaaaaacatggtaa

DBGET integrated database retrieval system