KEGG   Sulfobacillus acidophilus TPY: TPY_3806Help
Entry
TPY_3806          CDS       T01576                                 

Gene name
fucA
Definition
protein FucA
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:say00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3533684..3534319)
Genome map
AA seq 211 aa AA seqDB search
MDALMAVIDQIQADRITFAASGNVSVRDPRHPDRFWITPSGVAWPHITYDDLVALSVETG
TVLDGRLKPSTEWRFHRTLYARHDWIGGVVHLHSRYATIFSTLGEPIKPVHYQMARVAYQ
VPVVPYETYGTPALAEAVGTVIDKDCQAALLANHGLVAVGDTVAKAYQYAQEIEWMADIY
YHARLLGTPRILTVEEIEKVRDQFAQYGQTP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttaatggccgtcatcgaccaaattcaagcggatcggatcacgttcgccgcc
tccggcaacgtcagtgtccgagacccgcgacatccggatcgtttttggattaccccgtcg
ggtgtggcttggccccacattacgtatgacgatttggtcgccctgtcggtcgagaccggg
acggtgcttgatggccggttaaagccctccaccgaatggcggtttcaccggacgctctat
gcacggcacgactggataggtggggtggtccacctccattcccgctacgcgacgattttt
tcgacactgggagaaccgataaaaccggttcactatcaaatggcccgtgtggcttaccag
gtgcccgtggtaccctacgaaacctatggcacgccggccttggccgaagccgtgggaacc
gtgattgataaagattgccaagcggctctgttggccaatcatggactcgtcgccgtcggc
gacacggtcgccaaggcctatcaatatgcccaggaaatcgagtggatggccgatatctat
tatcatgcccgtcttctgggcacgccccgcattttaaccgtcgaggaaattgaaaaggtt
cgcgaccaatttgcccaatacggtcaaaccccttga

DBGET integrated database retrieval system