KEGG   Shewanella amazonensis: Sama_0083Help
Entry
Sama_0083         CDS       T00445                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
saz  Shewanella amazonensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sama_0083
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sama_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(92823..93776)
Genome map
AA seq 317 aa AA seqDB search
MHTPALNTSLTIPPALKALYQRCELGSLATSPGVDIAWLALEHPSPKGSIVFSNGRVEAF
LKYLELYQDFYDAGYSVYALDHRGQGLSSRLTPNRHMGHVAHFSDYVTDFNHFIDQVVRP
RAKAPLFLAGHSMGGAIGTLYLQAHSGLFSAACFSAPMYGICLPMNKVFVRWLAQKLDAS
AKGLPNYILGGKDYHPAPFAKNDLTKSEARYQAYRELYEQNPQLQLGSPTNRWLLEALDA
CDEAVLAARESKIPLLVLQASEDTIVDNKAQNRAMGGLCECLQINDARHEILMECDGPRT
KAIEAMLGFFASHAKQR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaccagctttgaatacatctttgacaattccacctgcccttaaggcgctgtat
cagcgctgtgagctgggcagcctcgccaccagccccggcgtcgacatcgcctggctggca
ctggaacaccccagtcctaagggcagcattgttttttccaatggccgggttgaggccttt
ctcaagtatctggagctgtaccaggatttttatgacgctggctacagtgtctacgcactg
gaccatcgcggtcagggtctatcgagccgtcttacgcccaaccgccatatgggccatgtg
gcgcacttcagtgactatgtcactgacttcaatcattttatagaccaggttgtgcgcccc
cgagccaaagcgccgctgtttctggctggccactccatgggcggcgccataggcaccctg
tatttgcaggcgcattcgggcctcttcagtgccgcctgtttctcggcccccatgtacggc
atctgcctgcccatgaacaaggtgtttgtgcgctggctggcgcaaaagctggatgccagc
gctaaagggctacccaactacattctcgggggcaaggactatcatccggccccctttgcc
aaaaacgacctcaccaaaagcgaggcccgttatcaggcctaccgcgagctctatgagcaa
aacccgcaattgcaactgggctcgcccaccaaccgctggctgctggaagcattggatgcc
tgtgacgaagcggtattggcggcgcgggagagcaaaatccctttgctggtgttgcaggcg
agtgaagacaccatagttgacaacaaagcccagaacagggccatgggtggactgtgcgaa
tgcttgcagattaacgacgcccgccatgagattttgatggaatgcgacggcccacgcacc
aaggcgatagaggcgatgctgggcttttttgccagccatgccaagcagcgctga

DBGET integrated database retrieval system