KEGG   Shewanella amazonensis: Sama_0191Help
Entry
Sama_0191         CDS       T00445                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
saz  Shewanella amazonensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sama_0191
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sama_0191
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sama_0191
Lipid biosynthesis proteins [BR:saz01004]
 Desaturase
  First
   Sama_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(219402..220520)
Genome map
AA seq 372 aa AA seqDB search
METIMNKPPIIWLNLSLFVLTLGGAITLVPWRAITHGFDAVEWVAFVVLVFYSGLSITAG
YHRLWSHKAYKANAVVRFFYALGGALALQNSALHWSSDHRVHHKHVDNNDKDPYSANMGF
WYSHIGWMLREYQAHRYHDYNNVRDLQNDTIVMWQHKHYLLLTILMNVGLPALLGWFHGD
VLSMLLLAGLARLVLVHHCTFFINSLAHIWGSQPYTDKNTARDNPLLAFLTYGEGYHNFH
HIFENDYRNGIHWWDYDPTKWLIKGLSWCGLAGDLRKVPQERIESAKLQMQLKRSQHRIA
GHKDAEELLESLQLEYERLKQQLLAYYEAKKELLEARRAELCVKELSPKVAELKNRLRLA
QQNWASVTAACR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaataatgaataaaccccccatcatttggctgaacctctctctgttcgttcta
acccttggcggtgcaattaccctggttccgtggcgagctatcacccatggctttgacgcc
gttgaatgggtcgcctttgtggtcttggtattttacagcggcctctctattactgcgggc
tatcacaggctttggtcacacaaggcgtacaaggccaatgccgtggtacgcttcttttat
gcactcggtggtgcactggcattgcaaaacagcgccttgcactggtcttcggatcaccgg
gtgcaccacaagcatgtcgacaacaacgacaaagacccctattcagcgaacatgggtttc
tggtatagccatatcggctggatgctgagggagtatcaggcccacagatatcacgactac
aacaacgtacgcgatcttcaaaacgatactatcgtcatgtggcaacacaaacattatttg
ctattgaccattttgatgaatgtgggtctgccggcgctgctgggctggtttcatggtgat
gtgctgtcgatgttactgttggcaggtttggcgcgtttggtgctggttcaccactgcact
ttctttatcaactcactggcgcacatctggggctcgcagccttataccgacaagaacacc
gcccgcgacaatccgctgctggcgtttttaacctatggcgagggctaccacaacttccac
catatctttgaaaacgactaccgcaatggtatccactggtgggactacgacccaaccaag
tggcttatcaagggcttgtcctggtgtggattggccggtgacttacgcaaagtgccacag
gaacgtatcgaaagcgccaaactgcagatgcagctcaagcgcagccaacatcgcattgcc
ggccataaagatgccgaagagctactggaatccctgcagctggaatacgagcgtctgaag
caacagctcctggcctactacgaagctaaaaaagaactgctggaagcccgtcgtgccgag
ctttgtgtaaaagaactctcacccaaggtagcggagctgaagaaccgcctgcgtctggcg
cagcaaaactgggcatcagtgacagccgcctgtcgctga

DBGET integrated database retrieval system