KEGG   Shewanella amazonensis: Sama_0341Help
Entry
Sama_0341         CDS       T00445                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
saz  Shewanella amazonensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sama_0341
Enzymes [BR:saz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sama_0341
Exosome [BR:saz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sama_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
410502..411989
Genome map
AA seq 495 aa AA seqDB search
MDKQYVVALDQGTTSSRAIVFDRDANLVAVSQREFTQIYPKGGWVEHDPMEIWASQSSTL
IEVLARAGIHSDEVAAIGITNQRETTIIWDKLTGKPVCNAIVWQCRRSAAICEALKAQGL
EPLFRDKTGLLLDPYFSGTKIKWILDNVPGVRERADAGELLFGTVDTWLVWKLTEGKVHV
TDPTNASRTLMYNIHSGEWDSELLKALDIPASLLPEVKSSQAVYGTTRIAGEGTEIPVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGKQAVKSEHGLLTTIAVGDDGGISYA
LEGAVFMGGATIQWLRDELGLIRDASDTEYFASKVDDTNGVYLVPAFVGLGAPYWDPDAR
GTLVGLTRGANRNHIIRAALESIAYQSRDLLDAMSKDSGVALKQLKVDGGAVANDFLMQF
QADISGVEVLRPAQTETTAMGAAFLGGLAVGFWSNVDEIRHKSGIDRRFVPLMDDKERAT
LYLGWQDAVRRSLSS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggacaagcaatatgtggttgcgctggatcagggcacaaccagttcccgcgccattgtt
tttgaccgggatgccaacctggtggcggtgtcgcagcgcgaattcactcaaatttacccc
aagggcggctgggtcgagcacgaccccatggagatctgggcatcccagagctcgaccctg
attgaagtcctggcccgtgccggtattcacagcgatgaagtggctgctataggtatcacc
aatcagcgtgaaaccaccatcatctgggacaaactcacgggtaaacctgtgtgcaatgcc
atcgtatggcagtgccgccgcagtgccgcgatctgtgaagcgcttaaagctcagggtttg
gagccgctgtttcgcgataaaacaggcctcctgctcgacccttatttttccggcaccaaa
atcaaatggattctggacaatgtgcccggtgtgcgtgagcgtgccgacgcgggtgagctg
ctgtttggcaccgtggatacctggctggtgtggaaactcaccgaaggtaaggtccatgtc
accgaccccaccaatgcttcacgcaccctgatgtacaatatccattctggcgaatgggac
tcggagttgctgaaggcgctggatattccagccagcttattgccagaggtaaagtcgtct
caggcggtgtatggcaccacccgtatcgccggtgagggtactgaaatcccggtggcaggt
atggccggcgatcagcaggcggcgttgtttggccagctgtgtgtcgagcccggtatggcc
aaaaatacctacggtaccggctgctttttgctgatgaatacgggtaaacaagctgtcaaa
tcagagcatggtctgctgactaccattgccgtgggcgatgatggtggtatcagctatgca
ctggagggcgccgtgtttatgggcggtgccaccattcagtggcttagggacgagctgggg
ctgattcgtgatgccagcgataccgaatattttgcgtccaaggttgacgacactaatggc
gtgtatctggtaccggcctttgtgggccttggcgcgccttattgggatccggatgcccgc
ggcaccttggttgggctgacccgcggtgctaaccgtaaccacatcatccgggcggcgctg
gaatccattgcctaccaaagccgtgacctgctggatgccatgagcaaagacagcggcgtg
gcgctcaaacagctcaaggtggatggcggcgcggtagccaacgattttttgatgcagttt
caggccgatatctcgggagttgaagtgctgcgcccggcacagacggaaaccaccgctatg
ggcgcggcgttccttggtggtctcgccgtcggtttctggtccaatgtggatgaaatacgg
cacaagagcggcatagacaggcgctttgtgccactgatggatgataaagaaagagcgacg
ctttaccttggatggcaagatgctgtgcgccgaagcctgagtagctga

DBGET integrated database retrieval system