KEGG   Shewanella amazonensis: Sama_0375Help
Entry
Sama_0375         CDS       T00445                                 

Definition
(GenBank) pyruvate dehydrogenase, E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
saz  Shewanella amazonensis
Pathway
saz00010  Glycolysis / Gluconeogenesis
saz00020  Citrate cycle (TCA cycle)
saz00620  Pyruvate metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
Module
saz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sama_0375
   00020 Citrate cycle (TCA cycle)
    Sama_0375
   00620 Pyruvate metabolism
    Sama_0375
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Sama_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ABL98586
JGI: Sama0375
UniProt: A1S2I0
Position
453823..456519
Genome map
AA seq 898 aa AA seqDB search
MSEPMQMLQDLDPIETQEWLAALESVVREEGVERAQFLLEQVLEQARLDGVDMPTGITTN
YVNTIPLTQEPAYPGDITIERRIRSIIRWNAIMIVLRASKKDLELGGHMASFQSAAAFYE
VCFNHFFRAPNHKDGGDLVYYQGHIAPGIYSRAFLEGRLTEEQLDNFRQEVDGKGISSYP
HPKLMPEFWQFPTVSMGLGPISSIYQARFLKYLNGRGLKDTTEQRVYAFLGDGEMDEPES
RGAISFAAREKLDNLCFLINCNLQRLDGPVMGNGKIIQELEGLFKGAGWNVIKVVWGSGW
DKLLAKDTTGKLLQLMNETVDGDYQTFKAKDGAYVREHFFGKYPETAALVADMTDEEIFA
LKRGGHEPSKLYAAFKAAQETKGRPTVILAKTVKGYGMGDAAEGKNIAHQVKKMDMSHVA
KLRDRLGVTDLVSDEDLVNLPYIKLEEGSVEHTYLHARREALHGYTPKRLPNFTGEFVAP
ELSEFKPLLEEQKRDISTTMGFVRTLNILLKDKNIGKNIVPIIADEARTFGMEGLFRQIG
IYNPYGQNYIPEDRDIVSYYKEDTSGQVLQEGINELGAMSSWVAAATSYSTNNLPMIPFY
IYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTLNGEGLQHEDGHSHILAGTVPNCI
SYDPTFAYETAVIIQDGIRRMYGEQENVFYYLTLMNENYAMPAMPEGAEEGIRKGIYKLE
SHTGGKGSAYSPAKPSKVQLMSSGTIMNEVRKAAVILAEEYGIGSDVFSVTSFNELARNG
QDCERFNMLHPEADARVPYITSVLGSEPAIAATDYMKNYAEQVRAFMPSVSYKVLGTDGF
GRSDSRANLRRHFEVNAGYVVVAALNELAKRGDIEKSVVVAAIKKFDIDTEKMNPLYA
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacctatgcaaatgctacaagacttagatcccatcgaaacccaggagtggctg
gcggccctcgagtccgttgttcgcgaagaaggcgtcgaacgtgcccaattcctgctggag
caagtgttggagcaggcccgtcttgatggtgtggacatgccaaccggcatcaccaccaac
tatgtgaacaccatccccttgactcaggaaccggcttaccctggtgatatcaccattgaa
cgccgcatccgttccatcattcgctggaacgccatcatgatagtactgcgcgcctccaag
aaagatctggagctgggtggtcacatggcgtctttccagtcggcggctgctttctacgaa
gtgtgtttcaaccactttttccgcgcccccaaccacaaagatggtggcgacctggtttac
tatcagggccacattgcccccggtatttatagccgtgctttcctcgaaggtcgtctgacc
gaagagcagctggacaacttccgtcaggaagtggacggcaagggtatttcgtcttaccca
caccccaagctgatgcctgaattctggcaattcccaaccgtatccatgggtctgggccct
atctcttctatttatcaggcacgcttcctcaagtacctgaatggccgtggactgaaagac
accaccgagcagcgcgtgtacgccttcctcggcgatggtgaaatggacgagccggaaagc
cgcggtgctatctccttcgctgcccgtgagaagctggacaacctgtgcttcctcatcaac
tgtaacctgcagcgtctcgacggcccggtaatgggtaacggcaaaattatccaggaactc
gaaggcctgtttaaaggcgcgggctggaacgtaatcaaggtagtgtggggcagtggctgg
gacaagctgctggccaaagacaccaccggcaagctgctgcagctgatgaacgaaaccgtt
gacggtgactatcagaccttcaaggccaaagatggtgcctacgtgcgtgagcacttcttc
ggtaagtacccagagacggctgctctggttgccgacatgaccgacgaagaaatcttcgcc
ctaaagcgcggtggccatgagccttccaagctgtacgcggcattcaaagctgcccaggag
accaaggggcgtccaactgtgatcttggccaagactgtaaaaggttacggcatgggcgat
gcggccgaaggcaagaacatcgcgcaccaggtgaaaaagatggacatgtcccacgtggcc
aagctgcgtgaccgtctgggtgtgacggatctggtcagcgacgaagatctggttaatctg
ccatacatcaagctcgaagaaggcagtgttgagcacacctatttgcacgcccgtcgtgaa
gccctgcacggctacacgcccaagcgtctgcctaacttcaccggcgagtttgttgcccct
gaactgtctgagttcaagccgctgctggaagagcagaagcgtgatatttctaccaccatg
ggctttgttcgtaccctgaacatcctgctcaaggacaagaatatcggcaaaaacatcgtg
cctattatcgccgacgaagcccgtaccttcggtatggaaggtctgttccgtcagattggt
atctataacccctacggccagaactacattccggaagaccgcgatatcgtgtcttactac
aaggaagacacttcaggccaggtactgcaagaaggtatcaacgagctgggcgccatgtct
tcatgggttgccgctgccacctcgtacagcaccaacaacctgccaatgatcccgttctac
atctactactccatgttcggcttccagcgtgtgggcgatatggcgtggatggcaggcgac
cagcaggcgcgcggcttccttttgggtgccactgccggtcgtaccaccttgaacggtgaa
ggtctgcagcacgaagacggtcacagccacatcctggccggtaccgtacctaactgtatt
tcttacgatccgacctttgcttacgaaactgccgtgatcattcaggacggtatccgccgc
atgtatggcgagcaggagaacgtgttctactacctgaccctgatgaacgaaaactacgcc
atgccagccatgccagaaggtgccgaggaaggtatccgcaagggtatctacaaactcgaa
agccatacaggtggcaagggcagtgcctacagcccagcgaagccatcaaaagtgcagttg
atgagctcaggcaccatcatgaatgaagtacgtaaagccgcggttatcctggctgaagaa
tacggcataggttcagatgtgttctccgtgacttcgttcaacgagctggcccgtaacggt
caggactgcgagcgtttcaatatgctgcatcctgaagctgacgcccgcgtaccttacatc
acctcagtactgggcagcgagcctgccattgccgcgaccgactacatgaagaactacgcc
gaacaggttcgtgccttcatgccaagcgtgtcctacaaggtgctgggtaccgacggtttc
ggtcgctctgacagccgcgccaacctgcgtcgtcacttcgaagtgaacgccggttacgtg
gtggttgcagccctgaacgagctggccaagcgcggtgacatcgagaaatctgtggtggtt
gctgccatcaagaagttcgatatcgacaccgagaagatgaacccactttacgcgtaa

DBGET integrated database retrieval system