KEGG   Shewanella amazonensis: Sama_0375Help
Entry
Sama_0375         CDS       T00445                                 

Gene name
aceE
Definition
pyruvate dehydrogenase subunit E1
Orthology
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
saz  Shewanella amazonensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:saz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saz00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:saz00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:saz00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
453823..456519
Genome map
AA seq 898 aa AA seqDB search
MSEPMQMLQDLDPIETQEWLAALESVVREEGVERAQFLLEQVLEQARLDGVDMPTGITTN
YVNTIPLTQEPAYPGDITIERRIRSIIRWNAIMIVLRASKKDLELGGHMASFQSAAAFYE
VCFNHFFRAPNHKDGGDLVYYQGHIAPGIYSRAFLEGRLTEEQLDNFRQEVDGKGISSYP
HPKLMPEFWQFPTVSMGLGPISSIYQARFLKYLNGRGLKDTTEQRVYAFLGDGEMDEPES
RGAISFAAREKLDNLCFLINCNLQRLDGPVMGNGKIIQELEGLFKGAGWNVIKVVWGSGW
DKLLAKDTTGKLLQLMNETVDGDYQTFKAKDGAYVREHFFGKYPETAALVADMTDEEIFA
LKRGGHEPSKLYAAFKAAQETKGRPTVILAKTVKGYGMGDAAEGKNIAHQVKKMDMSHVA
KLRDRLGVTDLVSDEDLVNLPYIKLEEGSVEHTYLHARREALHGYTPKRLPNFTGEFVAP
ELSEFKPLLEEQKRDISTTMGFVRTLNILLKDKNIGKNIVPIIADEARTFGMEGLFRQIG
IYNPYGQNYIPEDRDIVSYYKEDTSGQVLQEGINELGAMSSWVAAATSYSTNNLPMIPFY
IYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTLNGEGLQHEDGHSHILAGTVPNCI
SYDPTFAYETAVIIQDGIRRMYGEQENVFYYLTLMNENYAMPAMPEGAEEGIRKGIYKLE
SHTGGKGSAYSPAKPSKVQLMSSGTIMNEVRKAAVILAEEYGIGSDVFSVTSFNELARNG
QDCERFNMLHPEADARVPYITSVLGSEPAIAATDYMKNYAEQVRAFMPSVSYKVLGTDGF
GRSDSRANLRRHFEVNAGYVVVAALNELAKRGDIEKSVVVAAIKKFDIDTEKMNPLYA
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacctatgcaaatgctacaagacttagatcccatcgaaacccaggagtggctg
gcggccctcgagtccgttgttcgcgaagaaggcgtcgaacgtgcccaattcctgctggag
caagtgttggagcaggcccgtcttgatggtgtggacatgccaaccggcatcaccaccaac
tatgtgaacaccatccccttgactcaggaaccggcttaccctggtgatatcaccattgaa
cgccgcatccgttccatcattcgctggaacgccatcatgatagtactgcgcgcctccaag
aaagatctggagctgggtggtcacatggcgtctttccagtcggcggctgctttctacgaa
gtgtgtttcaaccactttttccgcgcccccaaccacaaagatggtggcgacctggtttac
tatcagggccacattgcccccggtatttatagccgtgctttcctcgaaggtcgtctgacc
gaagagcagctggacaacttccgtcaggaagtggacggcaagggtatttcgtcttaccca
caccccaagctgatgcctgaattctggcaattcccaaccgtatccatgggtctgggccct
atctcttctatttatcaggcacgcttcctcaagtacctgaatggccgtggactgaaagac
accaccgagcagcgcgtgtacgccttcctcggcgatggtgaaatggacgagccggaaagc
cgcggtgctatctccttcgctgcccgtgagaagctggacaacctgtgcttcctcatcaac
tgtaacctgcagcgtctcgacggcccggtaatgggtaacggcaaaattatccaggaactc
gaaggcctgtttaaaggcgcgggctggaacgtaatcaaggtagtgtggggcagtggctgg
gacaagctgctggccaaagacaccaccggcaagctgctgcagctgatgaacgaaaccgtt
gacggtgactatcagaccttcaaggccaaagatggtgcctacgtgcgtgagcacttcttc
ggtaagtacccagagacggctgctctggttgccgacatgaccgacgaagaaatcttcgcc
ctaaagcgcggtggccatgagccttccaagctgtacgcggcattcaaagctgcccaggag
accaaggggcgtccaactgtgatcttggccaagactgtaaaaggttacggcatgggcgat
gcggccgaaggcaagaacatcgcgcaccaggtgaaaaagatggacatgtcccacgtggcc
aagctgcgtgaccgtctgggtgtgacggatctggtcagcgacgaagatctggttaatctg
ccatacatcaagctcgaagaaggcagtgttgagcacacctatttgcacgcccgtcgtgaa
gccctgcacggctacacgcccaagcgtctgcctaacttcaccggcgagtttgttgcccct
gaactgtctgagttcaagccgctgctggaagagcagaagcgtgatatttctaccaccatg
ggctttgttcgtaccctgaacatcctgctcaaggacaagaatatcggcaaaaacatcgtg
cctattatcgccgacgaagcccgtaccttcggtatggaaggtctgttccgtcagattggt
atctataacccctacggccagaactacattccggaagaccgcgatatcgtgtcttactac
aaggaagacacttcaggccaggtactgcaagaaggtatcaacgagctgggcgccatgtct
tcatgggttgccgctgccacctcgtacagcaccaacaacctgccaatgatcccgttctac
atctactactccatgttcggcttccagcgtgtgggcgatatggcgtggatggcaggcgac
cagcaggcgcgcggcttccttttgggtgccactgccggtcgtaccaccttgaacggtgaa
ggtctgcagcacgaagacggtcacagccacatcctggccggtaccgtacctaactgtatt
tcttacgatccgacctttgcttacgaaactgccgtgatcattcaggacggtatccgccgc
atgtatggcgagcaggagaacgtgttctactacctgaccctgatgaacgaaaactacgcc
atgccagccatgccagaaggtgccgaggaaggtatccgcaagggtatctacaaactcgaa
agccatacaggtggcaagggcagtgcctacagcccagcgaagccatcaaaagtgcagttg
atgagctcaggcaccatcatgaatgaagtacgtaaagccgcggttatcctggctgaagaa
tacggcataggttcagatgtgttctccgtgacttcgttcaacgagctggcccgtaacggt
caggactgcgagcgtttcaatatgctgcatcctgaagctgacgcccgcgtaccttacatc
acctcagtactgggcagcgagcctgccattgccgcgaccgactacatgaagaactacgcc
gaacaggttcgtgccttcatgccaagcgtgtcctacaaggtgctgggtaccgacggtttc
ggtcgctctgacagccgcgccaacctgcgtcgtcacttcgaagtgaacgccggttacgtg
gtggttgcagccctgaacgagctggccaagcgcggtgacatcgagaaatctgtggtggtt
gctgccatcaagaagttcgatatcgacaccgagaagatgaacccactttacgcgtaa

DBGET integrated database retrieval system