KEGG   Shewanella amazonensis: Sama_0376Help
Entry
Sama_0376         CDS       T00445                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
saz  Shewanella amazonensis
Pathway
saz00010  Glycolysis / Gluconeogenesis
saz00020  Citrate cycle (TCA cycle)
saz00620  Pyruvate metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
Module
saz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sama_0376
   00020 Citrate cycle (TCA cycle)
    Sama_0376
   00620 Pyruvate metabolism
    Sama_0376
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sama_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABL98587
JGI: Sama0376
UniProt: A1S2I1
Position
456531..458459
Genome map
AA seq 642 aa AA seqDB search
MAIEIHVPDIGTDEVEVTEILVKVGDSITEDQSLITVEGDKSSMEVPAPKAGVVKEIKIA
VGDKVATGSLIMMFEGEQAAAAPAAQAAAPVPVAAAPAATAVAALKDVFVPDIGGDEVEV
TEILVKVGDSITDEQPLITVEGDKASMEVPAPFAGVLKEIKVATGDKVATGSLIMVFETQ
AASAAPVAAAAPVAAAAAPAPVAAAPVAGGDKDIHVPDIGGDEVEVTEVLVKVGDTVAAD
QSLLTVEGDKASMEVPAPVAGVVKAIKVAAGDKVSTGSLIMVFEVQGAAPAAAPAAPVAP
AAPQAAAPAANAQAQAPSQGQSKTGEFVENHEYAHASPVIRRLAREFGVNLAKVKGTGRK
GRVVREDVQSYIKEALKRLESGSATAAAGAASGAGLNLLPWPKVDFSKFGEVETQPLSRI
KKISGANLHRNWVMIPHVTQFDEADITELEDFRKAQNAEEAKRDTGMKITPLVFIMKAVA
KSLEAFPSFNASLSEDGESLILKKYINIGIAVDTPNGLVVPVVRDVNKKGIYELSRELAD
ISKKARAGKLTASDMQGGCFTISSLGGLGGTSFTPIVNAPEVGILGVSKSELKPKWNGKE
FVPRLMLPLSLSYDHRVIDGAEGAKFTTYLSGVLSDIRKLVL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaattcatgtacccgatatcggcactgatgaagtcgaagtgaccgagatc
ctggtcaaggtgggtgattccatcactgaggatcagtcgctgatcaccgtggaaggcgac
aagtcttccatggaagtaccggctcccaaggctggtgtggtcaaggaaatcaaaattgcg
gtgggcgacaaggtcgccaccggctcactgatcatgatgtttgaaggtgagcaagcagct
gctgctccggcggcccaggccgctgcgccagtgccggttgctgcagccccagctgctaca
gcggtagccgcgctgaaagacgtattcgtgcctgacatcggcggtgacgaagttgaagtc
actgaaattctggtgaaagtaggcgacagcatcactgatgagcagccactgatcacagta
gaaggcgacaaggcttctatggaagtgcctgcgccgttcgccggtgtgctcaaagaaatc
aaggtcgccaccggtgataaggtagccactggctcccttatcatggtgttcgagactcag
gctgcatccgctgctcctgtggccgcagctgctcctgtggccgcagctgctgcgccagcg
ccggttgccgccgcgccagttgccggcggtgacaaagacattcacgtgccggacatcggc
ggcgatgaagtggaagtgaccgaagtgctggtgaaggtaggcgacacagttgccgccgac
cagtcgctgctgacagtggaaggcgacaaagcctctatggaagtacctgcgccggttgcc
ggtgtggttaaggccatcaaggtggctgccggtgacaaggtgtctaccggttcactgatc
atggtgttcgaagtacaaggtgctgctcctgctgccgcgccagctgcacctgtggctccg
gccgctcctcaagctgcggctccggctgccaatgcccaggcccaggctccgtctcagggg
caaagtaagactggtgagttcgtggaaaaccacgagtacgcccacgcgtcaccggttatc
cgtcgtctggcccgtgagtttggcgttaaccttgccaaggtcaagggtacaggtcgtaag
ggccgagtggtacgtgaagacgtgcagtcttacatcaaagaagcactcaagcgcctcgag
tcaggctctgctaccgccgccgcgggcgctgcctccggcgctggcctgaacctgctgcca
tggccgaaggttgacttcagcaaatttggtgaagttgagactcagccgttgtcacgcatc
aagaagatcagtggtgccaacctgcaccgtaactgggtgatgatcccccatgtgactcag
tttgatgaggccgacatcaccgagcttgaggacttccgcaaggcgcaaaacgccgaagaa
gccaagcgcgataccggtatgaagatcaccccgctggtgttcatcatgaaggcggtggcc
aagtcgctggaagccttcccatcattcaacgcgtctctgtctgaagatggcgagagcctt
attctgaagaagtacatcaacatcggcattgcggtggatacccccaatggtctggtggtg
cctgtggtacgtgatgtgaacaagaaaggcatctatgagctgtcccgcgagctggctgac
atctccaagaaggcccgcgccggtaagcttactgcctctgacatgcagggcggctgcttt
accatctccagcctcggtggcctcggtggtacctcgttcaccccaatcgtgaatgcccct
gaagtgggtattctgggtgtgtccaagtctgagctcaagcccaagtggaacggcaaggaa
tttgtgcctcgcctgatgttgccactgtcgctgtcgtacgaccaccgggtgatcgacggc
gccgaaggtgccaagttcaccacgtatctgagcggtgtactgtcagacatacgcaaactc
gttctgtaa

DBGET integrated database retrieval system