KEGG   Shewanella amazonensis: Sama_0791Help
Entry
Sama_0791         CDS       T00445                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
saz  Shewanella amazonensis
Pathway
saz00230  Purine metabolism
saz00240  Pyrimidine metabolism
saz01100  Metabolic pathways
saz03030  DNA replication
saz03430  Mismatch repair
saz03440  Homologous recombination
Module
saz_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sama_0791
   00240 Pyrimidine metabolism
    Sama_0791
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sama_0791
   03430 Mismatch repair
    Sama_0791
   03440 Homologous recombination
    Sama_0791
Enzymes [BR:saz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sama_0791
DNA replication proteins [BR:saz03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sama_0791
DNA repair and recombination proteins [BR:saz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Sama_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABL98998
JGI: Sama0791
UniProt: A1S3P2
Position
complement(975962..976417)
Genome map
AA seq 151 aa AA seqDB search
MTQALFYVLPPSQMRDAAELLACRLAAFHYRRGAWVYIHCNDESQSFAIDEQLWQFDPND
FVPHNLKGEGPLGGAPVEIGHDRLGPSKNRGILINLAEKVPPFAVHFGHFIDFVAGDEAT
KALARLRFRELRGLGIEPSTQDLATQPLNLV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcactcttttacgtacttccgccgtcccaaatgagggatgctgccgagctg
ctggcctgccgtctggcggcgtttcattaccgccgcggcgcctgggtctatattcactgc
aacgatgaatcccaaagctttgccatcgacgagcaactttggcagtttgaccccaacgat
tttgtgccccacaacctcaagggtgaagggcctctggggggcgcgccggtggaaatcggt
cacgatcgcctcgggccgtcaaaaaaccgcggcattctgataaatcttgcagaaaaagta
ccgccttttgcggtacactttggccactttatcgactttgtcgccggtgacgaggccacc
aaggcactggcacggctgcgctttcgcgagcttcgcggccttggcatcgagccatccact
caggatttggcgacacaaccccttaatctagtttga

DBGET integrated database retrieval system