KEGG   Shewanella amazonensis: Sama_0907Help
Entry
Sama_0907         CDS       T00445                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saz  Shewanella amazonensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sama_0907
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sama_0907
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sama_0907
Enzymes [BR:saz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sama_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1095784..1097070
Genome map
AA seq 428 aa AA seqDB search
MELYNLKHPDERVSFSQAVKLGLGKDRGLFFPTHIPKLDDVETLLTLPFAQRSKKILGAW
LADELGQNVVDALVDKAFTFEVPLVKVDDTRYCLELFHGPTLAFKDFGARFMAQCLNVLA
GDERLTILTATSGDTGAAVADAFYGLDKVQVCVLYPKGKISLLQEKMFTTLGNNIHTVAV
ESDFDACQALVKQAFDDADVREGLHLNSANSINISRLLAQICYYFEAVAQYRKNFVDAPV
IAVPSGNFGNLTAGFFAKAMGLPVKRFVAATNSNDTVPRYLASANWQVNPTVATMSNAMD
VADPSNWPRVEAIAKVMGWSLAEIDGVALDEQQTRCALLALQEDGYLSEPHAAIAAQALK
ATLGKDERGIFLGTAHPAKFKDVVDHELSLDLPLPPELAAVADKPVLSANLAPDFAALKT
HLFETLRH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaattatacaatcttaagcatcccgatgagcgggtaagcttttctcaggcggtaaag
ctgggactgggtaaagaccgcgggctgtttttcccgactcatattcccaagctggatgat
gttgaaaccctgctgactttaccgtttgcgcagcgcagtaaaaaaatactgggtgcctgg
ctcgctgatgagttggggcaaaatgtggtggatgccctggtcgataaagcatttaccttt
gaggtgccgctggtcaaggtagacgacacgcgttattgcctggagcttttccacggcccg
actctggcattcaaagactttggtgcccgcttcatggcccagtgcctgaacgtgcttgcc
ggtgatgaacggctgaccattctcaccgccacctcaggtgatactggggctgctgtggcc
gacgccttctatgggctcgataaggtgcaggtctgcgtgctttatccaaaaggcaaaatc
agcctgctgcaggaaaagatgtttactaccctcggcaacaacattcacacggtggcggtt
gaatccgattttgacgcctgtcaggcgctggtgaaacaggcctttgatgatgccgacgtc
cgtgaaggactgcaccttaattcggctaactctattaatatcagtcggttgctggcacag
atctgctattacttcgaggccgtggctcagtatcgcaagaactttgtcgatgcaccggtt
attgccgtgcccagcggcaacttcggtaatctcaccgctggtttctttgccaaggccatg
ggcctgccggtgaagcgttttgtggccgccaccaacagcaacgacactgtgccgcgttat
ctcgccagcgcaaactggcaggtcaatcccacagtggccaccatgtccaatgccatggat
gtggcagaccccagcaactggcctcgtgtggaagccatcgccaaggtcatggggtggtcc
cttgctgagattgatggggtagcactggacgagcaacaaacccgttgtgctttgctggca
ttgcaggaagatggctacttgtccgaaccccacgcggccattgctgcacaagcgcttaag
gccacactaggcaaggacgagcggggtatttttctcggtacggctcatccggcgaagttc
aaagatgtggtcgaccatgagctgtctctggacttgcctttacccccagagcttgcggcg
gttgctgacaagccggttctgtcggccaatctggcgccggattttgccgcactcaagact
catttgtttgaaaccttgcgtcattga

DBGET integrated database retrieval system