KEGG   Shewanella amazonensis: Sama_0915Help
Entry
Sama_0915         CDS       T00445                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
saz  Shewanella amazonensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sama_0915
Enzymes [BR:saz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sama_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1105589..1107955)
Genome map
AA seq 788 aa AA seqDB search
MTQQHEITALKKFVRATNFLATSQIYLKQNVLHKRPLVHGDIKPRLLGHWGTCPGINFVY
ANVNRLIVKHKRPFLYLVGPGHGFPAVQANLFIEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGFGAVLDNPDLIATVLVGDGESETGPLAASW
YANRLVNPATCGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDDQLEED
VYEQMVKAMDLSYEMINDIQTRARNGEDVCKPRWPVILMRTAKGWTGVAEDKGKKLEGNC
ESHQVIVNKCATDKGHLEALDNWLASYGFAELCSVTEQGELQFDPDIKSLIPPKELCCGR
QRLSYGGEVVRALTNPDLTKLAYGAEVPRGHRGYSMNKMGEWMREAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDQDMSRDGRVLELLSENLLFGMMHGYTVTGRHG
MFPTYEAFSQVVSSMADQYCKYVYASQGVHFRKPLPSCNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPEIISAYLPADANSTLVYTERAYADRDKLNIIVAGKKELPQWLTLDEARRQ
AKDGLMIWDFASDDNPDVVLAGCGDYATQECMASLVLIRELLPRVRLRFVSVSELNSNGL
GSRKFQQKPWMMDEIFTKDKGVVFNYHGYPNTIKKLVFDYKGSHRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGIIDETQHVAITTDMLQRLVDHKNYIKANGVDPIH
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacagcacgagattaccgcactgaagaaatttgtgcgggccactaactttcta
gccacctcacagatttatctcaagcagaatgtgttacacaagcgaccactggttcacgga
gatatcaaacccagactgctcggtcactggggtacctgtcccggcatcaattttgtttat
gccaacgtcaaccgtctcatcgtaaaacacaagcgccccttcctctatttagttggccca
ggccatggcttccctgctgttcaggcaaacctgtttattgaaggctcactgagtcacttc
taccccgaaaccattccgtacaatgaaaccggcatcgaagatatctgtaagaaattttca
gccgcctacggttatccttcacatgccaacccagaagcgccaggacaaattctggagggt
ggtgagctgggttattccttgtctgtaggttttggtgccgtgctggacaaccccgatctg
attgccaccgtgctcgttggggacggtgagtccgagaccggccccctggccgcgtcctgg
tacgccaaccgcctggtcaacccagccacttgcggcgctgtactgccaatcgtgcacatt
aacgggtacaagatctcaggcccaacccgcatgggtcgtatgagccacgaagaactggat
cttgaattccgcggtctgggttatcaccccatcattgtggacgatcagctggaagaagat
gtctatgagcaaatggtcaaggccatggatctctcctatgagatgattaatgacatccaa
acccgtgcccgaaatggtgaagacgtttgtaagccacgctggccggtgatcctgatgcgc
accgccaaaggttggactggtgtagccgaagacaagggtaagaaacttgaaggtaactgt
gaatcgcaccaggttatcgtcaataagtgcgccacagataaaggccacctcgaagccttg
gataactggctggcaagctatggatttgcagagctttgcagcgtgacagaacagggcgaa
ctccagtttgaccccgatatcaagtcacttatcccgcccaaagaactctgctgtggtcgt
caacgcctgtcctatggtggcgaagtagtccgtgcactgaccaaccccgatctgaccaag
ttggcttacggcgcagaagtaccacgtggtcatcgtggctactccatgaataaaatgggc
gagtggatgcgtgaagccttcaaactgaaccgcgatcagcgcaatctgcgcatcttcagt
ccggatgaaacatactccaaccagctgcaagccgtatttgaagaaaccgatcgcgcgtgg
cagtggcctatcgaaagttgggaccaggacatgagccgcgacggccgcgtgttggagctg
ctgtctgaaaacctgctgtttggtatgatgcacggatacacggtaacgggtcgtcacggt
atgttcccaacctatgaggccttctcgcaggtggtctcttcaatggcggaccaatactgt
aaatacgtttacgcaagccagggcgtccatttccgtaagccactgccatcctgcaacgtc
gtactttcttctctgcttgagcgtcaggatcacaacggttattcgcaccagaaccccagc
ttcctcggtgccatgctggaaaaacacccagagatcatttctgcctatctgccagccgat
gccaacagcactctggtttataccgagcgtgcgtatgctgaccgcgacaaattgaacatc
attgttgcaggtaagaaagagctgcctcaatggttgaccctggatgaagcccgtcgccaa
gccaaagatggtctgatgatttgggactttgcctctgatgacaacccggatgtggtactg
gcgggctgtggtgactacgccacccaggagtgtatggcttcattggtactgattcgcgaa
ttgctgccacgggtacgtttacgcttcgtaagtgtgtctgaactcaactccaatggcctt
ggcagtcgtaagttccagcaaaagccctggatgatggacgaaatctttaccaaagataaa
ggcgtggtgttcaactaccacggttatccaaacaccatcaagaaactggtattcgattac
aaaggtagccacagattccgcattaagggctatgaagaggaaggttccacaaccacacca
ttcgatatgggcgtgcgaaatggcacttcacgctatcacctggtaatcgatatggcctat
aaattgttccagcaagggattatcgatgaaacccaacatgtggccatcaccacagatatg
ctgcaacgtttggttgaccataagaattatattaaggccaatggcgtagatccgattcac
atcgaaaattgggtgtggacccgttaa

DBGET integrated database retrieval system