KEGG   Shewanella amazonensis: Sama_0943Help
Entry
Sama_0943         CDS       T00445                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
saz  Shewanella amazonensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sama_0943
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sama_0943
Enzymes [BR:saz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sama_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1140745..1143399
Genome map
AA seq 884 aa AA seqDB search
MKFSLAASAIFLALGVSGCSQAPVEPAAVAAEPSVLTQASLQAFADGLDVKYRVVTNRPD
EQCKKDAGEGRCFQAEIVLTSPIDFDGRDFEIYYSQMRPVQSVQSTDFVIEHVKGDLHRI
KPTGNFGGFKANQSQTLAFRGELWQLSETDAMPNYYITAPGLKPVVIASTRLAVEAETGL
ELRPYVEAFTDADKQYRRTDNDKLPWATAPVLFEANQSLVVDPAAAAQRIVPAPVSQTFE
AGLGTLDLSGGIAVELPQGLDKAAIDAALARLARLGIEEDSSGARIKLVSDDSLGAEAYQ
LVIRPEGAEIKAATDAGFAYGLSSLAALVQPGKPAISAQTITDAPRYGFRGMHVDVSRNF
HSKAFMLSLLDQMAAYKLNKLHLHMGDDEGWRLEIDGLPELTEIGSKRCHDLAEDTCLLP
QLGSGPDADVKVNGFYSKADYIEILKYASARQIQVIPSMDMPGHSRAAVKAMEVRYRRLA
EVGDIKGAEEYRLIDPEDKTVYSSIQYYDDNTLNVCIESTYHFVDKVIDEIAKLHKEAGQ
PLTRYHIGADETAGAWLESPKCEAFVANNDKGVTNKSELGAYFIERVANVLHDKGIEPAG
WSDGMSHTRPEKMPAMNQSNIWDVVAHKGHQRAHKQANLGWEIVLSNPEVLYFDFPYEAD
PKEHGYYWASRATNSQKVFGFMPGNLPANAEQWLDIENNPFEADDTKQQDEAGKVLSEPM
QPGKAFYGVQGQLWSETIRSDEQAQYMIFPRLLMLAERAWHKPGWEVPYNHEGALYNQSS
GSFSAEARALQAADWQQMANTLGHKELAKLDLAGVHYRVPTVGARIEDGKLSANIAFPGL
GIEYREADGNWQPYLAPVVVTKLPVEVRGIAADGKRKGRTLKVK
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttccttagccgcatctgcgatttttctcgccttgggtgtcagtgggtgctca
caagccccggtcgagcccgctgccgtagccgctgagccttcggtgttaacccaggccagt
ttacaggccttcgccgatgggctggacgtgaaataccgggtggtaaccaacagacccgat
gaacagtgcaaaaaagacgccggtgaaggccgctgctttcaggccgaaattgtgctgaca
tcgcccatcgacttcgacggtcgcgattttgaaatctattacagccagatgcgcccggtg
cagtcggtgcaaagcacagactttgtgattgagcatgttaaaggcgatttgcatcgcatc
aagccaaccgggaatttcggcggattcaaggccaaccagagccagaccctggcgtttcgc
ggcgagctgtggcagctgtccgaaaccgatgccatgcccaactactacattacagcgccg
gggcttaagcctgtggtaattgccagtaccaggctggcggtcgaggctgaaaccggtctt
gagctgcgcccttacgtcgaagcctttaccgatgccgacaagcagtatcgtcgtaccgat
aacgacaaactgccatgggcaacggcgccagtgctgtttgaggcgaatcagtcgcttgta
gttgaccctgccgcggcggcccagcgcatagtgcctgcgcctgtgtcgcaaacatttgaa
gcgggtcttggcacgctggacttgtccggcggtattgccgttgaactgccacaggggctg
gataaagccgccatcgacgctgcgctggcacgtcttgcccgcctgggtattgaggaggac
tcatctggtgccaggattaagctggtaagtgatgactcacttggtgcagaagcctatcag
ctggttattcgcccagagggcgccgagattaaagccgccaccgatgccggctttgcctat
ggtctgtcgtcactggcagcgcttgtgcagccaggcaagccagctatcagtgcgcaaacc
atcactgatgcaccaagatacggctttcgcggcatgcacgtggatgtgtcccgcaacttc
cactccaaggcgtttatgctaagcctgcttgaccagatggcggcctataaacttaacaag
ctgcacctgcacatgggcgatgatgaaggctggcgcctcgaaattgatggtttgccggag
ctgaccgagataggcagcaaacgttgtcacgaccttgccgaagatacctgcctgctgccg
cagcttggcagtgggcctgatgccgatgtgaaggtaaacgggttctacagcaaggccgac
tatattgagatcctgaaatatgcctcagccagacaaattcaggtgatcccgtccatggac
atgcccggccacagccgcgctgccgtgaaagccatggaagtcagataccgccgcctggcg
gaagtgggtgatatcaagggcgctgaagaatatcgccttatcgatccggaagataagacg
gtttacagttctattcagtactacgacgacaacaccctcaacgtgtgcatcgagtcgact
taccactttgttgacaaggtaatcgacgaaattgccaaactgcataaagaagccggacag
ccgctgacccgttatcacattggcgccgatgaaaccgccggtgcctggcttgagtcgcca
aagtgcgaagcctttgttgcaaataacgacaagggagtgaccaacaagagtgagctgggt
gcttactttatcgagcgggtggccaacgtgctgcatgacaagggcattgagccagccggt
tggagtgatggcatgagccacacccgcccggaaaaaatgcctgccatgaaccagagcaac
atctgggatgtggttgctcacaaaggtcatcagcgtgcccacaagcaggctaacctcggc
tgggaaatcgtgctgtctaaccctgaggtgctgtatttcgatttcccgtacgaggccgat
ccgaaggagcatggctactactgggcgagccgcgccaccaacagccaaaaggttttcggc
tttatgccgggtaacctgccggccaatgccgagcagtggctggatattgagaacaatccc
ttcgaagccgacgacacaaagcagcaggatgaggcgggcaaggttctcagcgagcctatg
cagcctggtaaggccttctatggcgtgcagggccagctgtggagcgagaccattcgcagt
gacgagcaggcacagtacatgattttcccccgcctgctgatgttggcggagcgtgcctgg
cacaagccgggttgggaagtaccctacaaccatgaaggcgcgctctataaccagagcagt
ggcagtttcagcgccgaagcccgtgcgctgcaggccgcagattggcagcagatggccaac
acccttggccataaagagctggccaagctggatttggccggtgtgcactaccgtgtcccc
acagtcggtgcccgtattgaggatggtaagttgtcggccaatatcgcttttcccggcctt
ggcatcgaataccgtgaagccgatggcaactggcagccttatctggcgccggtagtggta
accaagttaccggttgaagtgcgaggtattgccgcagacggtaagcgtaagggcagaacc
ctgaaggtgaaataa

DBGET integrated database retrieval system