KEGG   Shewanella amazonensis: Sama_0974Help
Entry
Sama_0974         CDS       T00445                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
saz  Shewanella amazonensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:saz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1177666..1178997
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNAEALSKEEIQFFVKGITDNSVSEGQIAALGMAVYFNDMTMDERIALT
TAMRDSGTVLNWDSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGSGAFMPTYEASLELARSITAVANGAGTKTTALLT
DMNQVLASCAGNALEVKEAVDFLTGKYRNPRLYEVTMGLCAEMLVLGGLAANDADARTKL
NTVLDNGRAAEIFGKMVSGLGGPADFVESYDKYLPKASIIRPVYAERDGFAYSMVTRELG
LAVVTLGGGRRKPGDALDYSVGLSNVCALGQPINKDTPLAVIHAQSEAAFEEAARAVRGA
ITVSDKQPEKTPEIYQYVRAEDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggcacaagagattattcgcaaaaaacgcaacgcagaggccctcagcaaagaa
gaaattcaattctttgtgaaggggattaccgacaacagcgtatccgaaggacagattgcc
gcgctgggtatggcggtatatttcaatgacatgaccatggacgagcgtattgcgctgacc
acggccatgcgcgattcaggtaccgtgctcaactgggatagcctggggttgaacggccct
gttattgataagcacagcacaggcggtgtgggcgatgtgatttcgctgatgctcggcccc
atggccgcagcctgtggtggttatgtgcccatgatttcgggccgggggctgggtcatacc
ggtggcacactggataagtttgacgccattcccggttaccaaaccgagccctccagcgag
ctgttccgcaaagtggtaaaagaagccggtgttgccattattggccaaaccggggatctg
gtgcccgccgacaagcgtttctattccattcgagacaacaccgccacagttgagtccatt
tcacttatcaccgcatcgattctgtccaagaagctggccgcaggcctggatgcgctggca
atggacgtcaaggtaggcagcggcgcctttatgccgacctacgaagcctcgttggaactc
gcgcgctccattaccgccgtggctaacggcgccggcaccaaaaccacagcgctgctcacc
gacatgaatcaggtgttggcttcctgcgccggtaacgcgctggaagtgaaagaagccgtg
gatttcctgaccggaaaataccgtaatcctcgcctttacgaagtcaccatgggcctgtgc
gccgagatgctggtgctgggtggtctggccgccaatgacgccgatgcccgtaccaagctc
aacacagtgctggataacggccgtgctgccgagatttttggcaagatggtgtccggcctg
ggcggccctgctgatttcgttgaaagttacgataagtatctgcccaaggcatccataata
cgccccgtgtacgcagaacgtgacggctttgcctatagtatggtgacccgtgagctgggt
cttgccgtggtcactctgggtggtggccgtcgcaagcccggtgatgcactggattacagt
gtaggcttgtccaacgtgtgtgcccttggtcagccaataaacaaagacacgccgcttgcc
gtaatccatgcccagtctgaggccgcttttgaagaagccgccagggccgttcgtggggct
atcactgtcagcgacaagcaacccgaaaaaacacctgagatctatcagtacgtacgtgct
gaagatctgtaa

DBGET integrated database retrieval system