KEGG   Shewanella amazonensis: Sama_1042Help
Entry
Sama_1042         CDS       T00445                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
saz  Shewanella amazonensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1259913..1260548
Genome map
AA seq 211 aa AA seqDB search
MNQTGSTVAINLAKKLYDAGIRDNLVLQAIANTPREMFLDAALAHKAYENTALPIGQGQT
ISQPYIVARMTELVMQNRPQRVLEVGTGSGYQAAILAKLVPELCTIERIKALQIQARQRL
KRLDLHNVSFKYGDGWLGWPNRGPFDAIMVTAAAASLPTALLEQLSEGGRLIIPVGEDAQ
QLLAITRKGQEYSSEVIESVKFVPLVNGNLA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaccggctcgacggtggcaatcaaccttgcaaagaagttgtatgacgctggg
atccgcgacaacctcgttttgcaggccatcgccaacacgccccgggaaatgtttctggat
gcagctctggcacacaaagcctatgaaaacaccgcgctgcccataggtcaggggcagacc
atttcccaaccttatatcgtggcgcgcatgacagagctggtgatgcaaaaccggcctcaa
cgggtgctggaagtgggtacgggctctggctatcaggctgctatcctggcgaaactggta
ccagagctttgcaccatagagcggattaaggcactgcaaattcaggcaaggcaacgtctt
aagcgtctggatttgcacaatgtgtcttttaagtatggtgatggctggctgggttggccc
aaccgtggtccctttgatgccatcatggtgacagccgcagccgcaagcttaccaactgct
ttacttgagcaattgtctgaaggcgggaggctcattattccggtgggtgaggatgcccag
caattattggccattacccgcaaggggcaggagtattcctccgaggtcattgagtcggta
aagtttgtgcccttggtcaacggaaacctggcgtag

DBGET integrated database retrieval system