KEGG   Shewanella amazonensis: Sama_1080Help
Entry
Sama_1080         CDS       T00445                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
saz  Shewanella amazonensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sama_1080
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sama_1080
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sama_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1307678..1308172)
Genome map
AA seq 164 aa AA seqDB search
MTDLYQFAATTIKGEQQPLANYRGKVLLIVNTASKCGFTPQYQGLESLYRKYHDQGLEIL
GFPCNQFGAQEQGSESDIQSFCELNFGVTFPLFAKVDVNGEQAHPLFTHLKQEAPGLLGS
KAIKWNFTKFLVGRDGKVRDRFAPTTDPQKLEKDIEALLNEAAK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctgtatcaatttgccgccaccaccatcaagggcgagcagcagccattggcc
aactatcgcggtaaggtcttattgatagtcaataccgccagcaaatgtggctttaccccg
caatatcaagggctggaaagcctctatcgcaaataccatgaccaaggcctcgaaatactc
ggctttccctgcaaccagtttggcgcccaggagcaagggagtgagtcagacattcagagt
ttctgtgaactcaattttggtgtgacctttccgctgtttgccaaggttgatgtcaatggc
gagcaggcccacccgctgtttactcaccttaagcaggaagcaccgggcctccttggcagt
aaggccatcaaatggaacttcaccaagtttttggtcggccgtgacggcaaggtgagagac
aggttcgcccccactaccgatccccaaaagctggaaaaggatatcgaggcactgctgaac
gaagcggcgaaataa

DBGET integrated database retrieval system