KEGG   Shewanella amazonensis: Sama_1312Help
Entry
Sama_1312         CDS       T00445                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
saz  Shewanella amazonensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:saz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1595370..1595969
Genome map
AA seq 199 aa AA seqDB search
MKFSPLVDELIQSLRCLPGVGPKSAQRMAFALLESDRKAGIRLADTLSRAMSDVGHCQKC
RTFTEQSLCPICSSSRRGEADTLCVVETPADVLAIESGGHFQGRYFVLQGHLSPLDGIGP
EELGLSLLEGQLVGGGISELILATNPTVEGDATAHYIADIARRAGVAVSRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtccgctggtggatgagcttattcaaagtctgcgttgcctgccgggagtg
gggcctaaatcggcccagcgcatggcctttgcgctgctggaaagcgatcgtaaagcgggc
atccgcctggccgataccctgtcccgggccatgagtgacgtgggccactgccaaaagtgc
cgtaccttcaccgaacagtctctgtgcccgatttgctccagcagtaggcgcggagaggcc
gacaccctgtgtgtggtggaaaccccggcggatgtactggccatcgagtccggtggccat
tttcagggtcgctatttcgtgctgcaggggcacttatctccccttgacggcatagggcct
gaggagctggggctttctctccttgaaggccaattggtcggcggtggtatcagtgagctg
attttggccaccaaccctaccgtggaaggggacgccacggcacactacattgccgatatt
gcccgcagagcaggggtagcggtgagccggattgcccacggtgtgcccgtcggcggtgag
cttgagtacgtcgacagcaccaccctcgcgctgagctttaacggccgcttgccgctttaa

DBGET integrated database retrieval system