KEGG   Shewanella amazonensis: Sama_1326Help
Entry
Sama_1326         CDS       T00445                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
saz  Shewanella amazonensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sama_1326
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Sama_1326
Enzymes [BR:saz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sama_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1615624..1616649
Genome map
AA seq 341 aa AA seqDB search
MGFLMLDIAGTQLKREEEALLASPMTGGLILFSRNFENRAQLNALIASVRRVRSDLLIAV
DHEGGRVQRFREGFTQIPAMGDILPAAGQDLGLAKRWATELGFLMAVELLASDIDLSFAP
VLDVNGVSDVIGRRAFSANPDEITALADAFIRGMDSAGMRAVGKHFPGHGSVKADSHVAM
PVDSREAGEILNFDMQPFKQLIDAQRLDGVMPAHVVYDKLCPNPAGFSSFWLQEKLRGEL
GFDGVIFSDDLGMEGAAFAGDYPARARAALAAGCDMILVCNNRDGALSVLAAQASLNEID
GRARRNAATLRPDPIKAIRALDNHERWEKARELALSIGYQP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttgatgcttgatattgcaggcacccaacttaagcgtgaagaagaagcctta
ttggcttcccccatgactggcggtcttattctgttcagccgtaactttgaaaatcgcgcc
cagttaaatgccctgatagcgtccgttagaagggtacgctccgacctccttattgcagtc
gatcatgaaggtggcagggttcagcggtttcgcgagggattcacccaaattcctgcgatg
ggcgacatattgccagcggcaggccaggatttagggttggcgaaacgctgggccactgag
ctgggctttctgatggctgtggagctacttgccagtgatattgatttaagctttgccccc
gtgctggatgtcaatggggtaagtgacgtgattggcaggcgagcattcagcgccaatcca
gatgagattaccgcgctggctgatgcctttatccgcggcatggacagtgctggcatgagg
gctgtgggtaagcatttccccggtcatggcagcgttaaagccgactcccatgtggccatg
cctgtggatagccgcgaggcaggtgaaatcctgaactttgatatgcagccgtttaagcag
cttattgatgctcagcgtctcgacggtgtgatgcctgcccatgtggtgtatgacaaactg
tgtcccaatcccgccggattttcatctttctggttacaggaaaagctcagaggtgagctt
ggatttgacggcgtgatattttccgatgatctggggatggaaggtgccgcttttgctggc
gattatccggcccgggcccgtgcggcgctggcggcaggttgtgacatgattttggtctgc
aacaaccgtgacggggccttgtcggtattggccgctcaggcgtcactgaatgagattgac
ggcagggcgcgccgcaatgccgccacactgaggcctgatccaattaaagccatcagggca
ttggataaccacgaacgttgggaaaaagcccgggagctggccttgtctattggttatcag
ccttag

DBGET integrated database retrieval system