KEGG   Shewanella amazonensis: Sama_1428Help
Entry
Sama_1428         CDS       T00445                                 

Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saz  Shewanella amazonensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sama_1428
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sama_1428
  Amino acid metabolism
   00310 Lysine degradation
    Sama_1428
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sama_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1739373..1740575
Genome map
AA seq 400 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKPGEAVSRDQNLVDIETDKVVLEVVAPEDGHIAEFL
AQEGDTVLAEQVIAKFVAGAVAGQEVTKAQAEAAAPAAEAASDESNDALSPSVRRLIAEH
NLDASKIKGTGVGGRITKEDVDAFVKSGAGKAAAPAAKAAAPVALSGDRSDKRVPMTRLR
KTIASRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKKHGIRLGFMSFYVKAVTEA
LKRFPEVNAAIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIK
GRDGKLTVEDMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEIL
PMMYLALSYDHRIIDGRESVGFLVTIKEFLEDPTRLLLDI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgttctgccagaatccgtggctgatgccactatcgcc
acctggcacgttaagcctggtgaggctgtatctcgtgaccagaacctggttgatatcgag
accgacaaggttgtattggaagtggttgcaccagaagatggccacatcgctgagtttctg
gcccaggaaggtgacaccgttctggccgagcaggtgattgccaagtttgtggccggtgcc
gttgccggtcaggaagtgaccaaggcgcaagccgaagccgctgcccctgctgctgaagcc
gctagcgatgagagcaacgatgcactgagcccatcagtacgccgtctgattgccgaacac
aacctggatgccagcaaaatcaaaggcactggtgtaggtggccgtatcaccaaagaagac
gttgacgccttcgtgaaaagtggtgccggtaaagctgctgctcctgcggccaaagcagct
gctccggtggcactgtctggcgatcgctcggacaagcgcgtgcctatgacccgcctgcgc
aagaccattgccagccgtctgctggaagccaaaaactctaccgccatgctgactaccttc
aacgaagtcaacatgaagcctattatggatatccgtaagcagtatcaggatatcttcgag
aagaagcacggtatccgtcttggctttatgtctttctacgtgaaagcggtaactgaagcc
ctgaagcgcttcccagaagtgaacgcggctattgatggcgatgacatcgtttaccacaac
tacttcgacgtgagcatcgctgtgtctactccccgtggtctggttacgccagtactgcgt
gacaccgacaccatgagcctggctgacatcgagaaagcagtacgcgatctggccatcaag
ggccgtgacggcaagctgactgtggaagacatgaccggcggtaacttcactgtgaccaac
ggtggtgtattcggctcgctgatgtctaccccaattctgaacctgccacagagcgctatc
ctcggcatgcacgccatcaaggaccgcccaatggcagtcaatggtcaggttgaaatcctg
cccatgatgtacctggctctttcttacgaccaccgtatcatcgatggccgtgagtctgtt
ggcttcctggtaaccatcaaggaattcctggaagacccaacccgtctgctgctggacatc
taa

DBGET integrated database retrieval system