KEGG   Shewanella amazonensis: Sama_1485Help
Entry
Sama_1485         CDS       T00445                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
saz  Shewanella amazonensis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:saz01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1798568..1799155)
Genome map
AA seq 195 aa AA seqDB search
MAALLACLVLAFPLKAETILILGDSLSASYGMEENQGWINLMRPQLPSHTLINAAVSGET
SAGGLRRLPALLDSAKPELVFVMLGGNDGLRGFSPTELKKNLTKIIDLSIASGSRVLLSE
VMVPTNYGGRYAKAFADVYQELGTREGVTLMRFFMTDIIIDPTLMQRDGIHPNEAAQPKI
AEIMLPYFSSALTAK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggccgctttgctggcctgcctggtcctggcgttccccctgaaggccgaaactatatta
atcctcggtgacagcctgagtgcaagttacggtatggaagaaaaccaaggctggatcaat
ttgatgcgccctcaattgccatcccataccctgattaatgccgccgtgagcggcgaaacc
agcgccggtggtctgcgccgattgcccgccctgcttgactctgccaaacctgagctggtg
tttgtgatgttgggggggaatgacggcctgcggggattttcacccacagagctgaaaaag
aatcttacaaaaatcattgacctgagcatagcgtccggctccagggtactcttaagcgaa
gtcatggtacccaccaattatggtggtcgctacgccaaggcatttgctgacgtctatcaa
gagttgggaacccgtgaaggggttaccctgatgcggtttttcatgacagacatcattatt
gacccgaccctgatgcaacgggatggtatacatcccaacgaagcggcgcagccaaagata
gccgagattatgctgccctatttcagcagcgcacttaccgccaaatga

DBGET integrated database retrieval system