KEGG   Shewanella amazonensis: Sama_1647Help
Entry
Sama_1647         CDS       T00445                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
saz  Shewanella amazonensis
Pathway
saz00300  Lysine biosynthesis
saz01100  Metabolic pathways
saz01120  Microbial metabolism in diverse environments
saz01230  Biosynthesis of amino acids
Module
saz_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sama_1647
Enzymes [BR:saz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sama_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABL99853
JGI: Sama1647
UniProt: A1S647
Position
complement(2012345..2013493)
Genome map
AA seq 382 aa AA seqDB search
MSSPETHSDVIELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTTNLWARR
GTEGPVFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYIHGRGAADMKGSLAAMVVAAERF
VAEHPDHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWALVGEPSSTHLLGDVVK
NGRRGSLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIA
NINGGTGASNVIPGELKVMFNFRYSTEVTAETLIARVLGILDAHGLDYDIDWVFNGLPFL
TGEGPLLDATREAIFEVTGTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECV
KASDLELLTGCYQRILEKLLCN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcccagaaacccacagtgatgtgattgaactgacgcgcgagctcatttcacgc
ccgtctgtcaccccgcttgatgaaggctgtcaggacctgatggccaaacgtctcgccgcc
attggctttaccatcgagcccatggtatttgaagacaccaccaacctctgggcccgccgt
ggcactgagggtccggtattctgttttgcaggccacactgatgtggtgccggttggcgat
ctgaatcggtggcacaccccgccattcgatcctgtggtgattgacggttatatccacggc
cgcggcgccgccgacatgaaaggctcactcgccgccatggtggtggccgctgagcgattt
gtggccgagcacccggaccatcagggctccatcgcctttcttatcacctccgatgaagaa
ggcccctttattaatggcactgtgcgtgttgttgaaacgcttgaagcacgccatgaaaag
ataacctgggccttggtgggcgagccttccagcacccatcttctcggggatgtggtgaaa
aacggccgtcggggcagccttactggcaacctcacagtcaaaggtattcagggccatgtg
gcctacccccatttggccgataacccaatccacagggcggcaccggccctggcagagtta
tcccgtatcgagtgggacaagggcaatgaattcttcccgcccaccagttttcagattgcc
aacatcaacggcggcacgggcgcatccaatgtgatcccgggtgaactcaaggtgatgttc
aacttccgttactccaccgaagtgaccgctgagaccctgattgcccgcgtactgggtatt
ctcgatgcccatgggctcgattacgacatcgactgggtgtttaacggcctgcctttcctc
accggagaaggcccactgctggatgccacccgggaagcaattttcgaggtaacaggtacc
cacaccgacccgcaaaccaccggcggcacctccgatggccgctttatcgcgcccaccggt
gctcaggtgattgagctcggtccggtcaatgccaccattcacaaggtgaacgagtgcgtg
aaggcaagcgatcttgagctgctcaccggctgctaccagcgcattctggaaaagctgctg
tgcaactga

DBGET integrated database retrieval system