KEGG   Shewanella amazonensis: Sama_1759Help
Entry
Sama_1759         CDS       T00445                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2151993..2153060
Genome map
AA seq 355 aa AA seqDB search
MVNEPRAVKDEVFAMTLAAHKPKEKDESAGILRKAVPQMSALGIPVTPDNYAVWYAYYQG
ADLALVRAINGLMENQVSFSAEVCRGLYSSFIQNNAPEVLENVHLETQLLINGLLSKISL
LTSGSETFQLAIESFGQQLRLPQEAESLHRLVEGVLVEVDKVVSENADIHSSLKSMDQEL
NHLRAEITELSVISLTDKLTGLNNRRAFESRLAQEFLPSTPKCSLLVIDIDHFKQFNDTW
GHNAGDKVLVYVAQNLKQAVKGEDLVARYGGEEFVIVLKDTSAEDAANIAEKLRDRIANK
KLTLKKDNLDLGKVSVSIGVAKAYANETPEQFFERADGALYRAKGTGRNRVCLAD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaacgagccacgggcagttaaggatgaagtatttgccatgacactcgcagctcac
aaacccaaagaaaaagatgagtcggccgggatattgagaaaggccgtaccccaaatgtcg
gcactcggcattcccgtaacacccgacaattatgccgtttggtatgcctactatcagggg
gccgatttggcgcttgtcagggctatcaatggtttgatggaaaatcaggtctctttttct
gcggaggtgtgccggggactctacagcagttttatccagaataatgcacccgaagtattg
gaaaacgtgcacctggaaacccagttgctgatcaatgggctactcagcaaaatcagtctg
ttgacctcaggttctgagacatttcagctcgccatagaaagttttggccagcaattgcgg
cttcctcaggaagcggaatcgctgcatcgattggtggagggcgtgttggttgaggtggac
aaggtggtaagtgagaacgcggatatccactcaagtctcaagtcgatggatcaggaactc
aatcatctacgagctgaaataaccgagttgtcggtgatatcccttaccgataaattaacc
gggctgaataatcgccgtgcatttgaatctcgtttggcgcaggagtttttaccatcaacg
ccaaaatgttcgctgttggttatcgatattgatcactttaagcagtttaacgatacatgg
ggccacaatgccggagacaaggtgttggtgtatgtggcgcagaatctgaaacaggccgta
aagggcgaggatttggttgcccgctacggaggcgaagaatttgtcattgtgttgaaggat
accagcgctgaggatgcagccaacattgcggaaaagctgcgcgaccgtatcgccaacaaa
aaattgaccttgaagaaagacaatttggatttgggtaaggtatccgtatccatcggcgtc
gccaaggcctatgccaatgaaacccctgaacagttttttgagagggcggacggcgcgctt
taccgcgccaaaggcactggccggaaccgggtttgcctcgctgactag

DBGET integrated database retrieval system