KEGG   Shewanella amazonensis: Sama_1796Help
Entry
Sama_1796         CDS       T00445                                 

Definition
cation transporter E1-E2 family ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
saz  Shewanella amazonensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2187745..2190132
Genome map
AA seq 795 aa AA seqDB search
MSKQPCFHCNEPVLTGSQFITQIDGVDQVMCCPGCQAVSQAIVDAGLLSYYKYRTEPGSR
QTALIPESLNHFSAYDLPEVQQDFVQERDGREEVTLSIDGITCAACAWLIEHKLQKLDGV
ERIQVNSTTQRAFIRWQPALVKLSYILSAIGSIGYNAAPFQLDDQEVISKRNSRRFLLRL
GLAGFATMQVMMFALALYAGYFTDLETEFRDYFRWVSMIFAAPVVFYSAQPFYFSAIRAI
LSGKLNMDVSVSIAICGAYIASCVATIQGTGEVYFESVSMFTFFLLLGRYFEQNARQKAS
VSSSNLHKLVPLTASLVTAQGIEEVPAKKLQVGDIILVSPGDVVAADGKIVEGISGINES
MLTGEQLPISKAPGAEVFAGTINLEQPIRVEVTAIGQDQLVAEIIRLQELASNAKPAIAL
TADKLARYFSATILTIAAMTYVVWRQFAPEDAFWVTLSVLVATCPCALALATPTAVTCAT
GLFTRLGIISRNGSVFEKLPKIKTVVFDKTGTLTCGSFSFGDIKLFEGLEKSRALAIASA
LEQGSLHPIARLFARIPTKLEVTRQHHLVGAGVEGIIEGIRYLIGSAEYLKVPSEMIFPG
QWVYLGTRNNVLAAFEIQDKLRDDAKETVAALKAKHIELQIASGDTSAHLQQVASTLGIT
KVNGGLKPKGKLELVESLRSNNTLVAMFGDGINDAPVLAGADLSVAMGSGSAIAKNSADL
ILLGDHLHRFVEAMNIAVKTNQIIRQNLAWALGYNMLILPLAVTGHVVPYIAAIGMSASS
LIVVGNSLRLLRLKP
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaaccctgttttcactgtaacgaacctgtcttgaccggcagccaattcatc
acccaaatcgatggcgttgatcaggtgatgtgctgcccaggatgtcaggcggtttcccag
gccatcgtcgatgctggcctgctttcctattacaaataccgcaccgagcccggcagtcgc
caaacggcgttgatccccgaaagcctgaatcatttcagcgcatacgatttgccagaagta
cagcaggatttcgttcaggaacgggatggccgggaagaagtcacgctcagcatcgatggc
attacctgcgctgcctgtgcctggctgattgaacataagctacaaaagcttgacggcgtc
gagcgtattcaggtgaactccaccacccagcgcgcgtttattcgctggcaaccggctttg
gtgaaattaagctatatcctgtccgccatcggcagcataggctataacgccgcgcccttt
cagttagacgaccaggaagtcatcagtaaacgtaacagccgccgctttttgctccggttg
gggctggcgggtttcgccaccatgcaggtgatgatgtttgccctggcactttatgccggc
tactttaccgatttggaaactgagtttcgtgattatttccgctgggtcagcatgatattt
gcggctcctgtggtgttctactcggcgcaaccattctatttcagcgccatacgcgccatc
ctgagtggcaagctcaatatggatgtatccgtttccattgccatttgcggagcctatatc
gcaagttgcgtcgccaccattcagggtacgggtgaggtctattttgaatctgtgtccatg
tttacctttttcttgctgcttggccgctattttgagcagaatgcccgtcaaaaggcttct
gtcagctcaagcaacttgcataaattggtgcccctcactgcgtcactcgttaccgcgcaa
ggaatagaagaagtccctgccaagaagcttcaggtcggcgacatcattttggtcagcccg
ggtgacgtggtcgcagccgatggcaagatagtggaaggcatatccggcattaatgaatcc
atgcttaccggagagcagctgccgatatccaaggcgccgggagcagaagtgtttgcaggt
accatcaacctggaacagcccatcagagtggaagtcaccgccataggccaggaccagctg
gttgcagaaattatccgactgcaggagcttgcttccaacgccaaaccggcaatagcactg
acggcagataagcttgcgcgttatttctcggccaccatactgaccattgccgccatgacc
tatgttgtgtggcgtcaatttgcacccgaagatgccttttgggtaacactttctgtgttg
gttgcgacctgcccttgcgcactagcccttgccacccctaccgctgtgacctgtgcaacc
ggactctttacccgattggggatcatttcccgtaatggcagtgtctttgagaaacttccc
aagataaagacggtggtatttgataagacaggaactctcacctgtggcagtttcagtttt
ggcgatatcaaactgtttgaggggttggagaaatcccgtgcactggctatcgcttcagcg
ttggagcaaggatccttgcatcccatcgcaagattgtttgccaggataccgacaaaactc
gaggtcaccaggcaacatcatctggttggggccggcgttgagggtatcatcgaaggtatc
cgttatctcattggcagtgccgaatacctgaaggtgccatcagaaatgatttttccgggg
caatgggtgtatctgggtaccagaaacaatgtgctggcggcttttgagatccaggacaag
ctgagagacgatgccaaagagaccgttgccgccctgaaagcaaaacacatcgaactgcag
atagccagcggtgatacctcggctcatctgcagcaggtggcatcaacgctcggtataacc
aaggtaaatggcggtctcaagccaaaaggcaagcttgagctggtcgagtcccttcggagc
aacaacacactggttgctatgttcggtgatggcattaatgatgcgcccgtgctcgcaggt
gccgatttatcggtggccatgggcagtggcagcgccatagccaaaaacagtgccgatctt
attttactcggtgaccacctgcaccgatttgttgaagccatgaatattgcggtgaaaacc
aaccaaataatcaggcagaatcttgcctgggcattggggtacaatatgctcatcttaccc
cttgccgtcaccggccatgttgtaccctatatcgcggccataggcatgtctgccagttcc
ctgattgtggtgggtaacagcctgaggctactgaggttaaaaccatga

DBGET integrated database retrieval system