KEGG   Shewanella amazonensis: Sama_1797Help
Entry
Sama_1797         CDS       T00445                                 

Definition
(GenBank) uncharacterized protein possibly involved in nitrogen fixation
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2190129..2190329
Genome map
AA seq 66 aa AA seqDB search
MSIIYILIPIAMLFVLIAVGVFFWAVRTEQFDDLDRQGASILFEEETPKAPLSGKSSSNN
NEADKR
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcatctacatcctcattcccattgccatgttgtttgtgctgattgcagtcggg
gtctttttttgggctgtccgaaccgaacaattcgacgatctagaccgccagggcgcgtca
atcctgtttgaagaagaaacccctaaagcgccactctctggcaagtcttcttcaaacaac
aatgaagcggacaagcgctga

DBGET integrated database retrieval system