KEGG   Shewanella amazonensis: Sama_1798Help
Entry
Sama_1798         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09792  
uncharacterized protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2190329..2191021
Genome map
AA seq 230 aa AA seqDB search
MDYSLSGAFLVGLMGGVHCFGMCGGLLGAFSSQIPAPPRHENPLAHRLGFLLSYNSGRIA
SYTLAGAIAGGASGGLSLLFDAGHLTLFLRFLAGLMMILLGLYVAKIWSGVVFIETLGKG
LWRVIQPFGKRLLPIDTRAKAVLAGSVWGWLPCGLVYSTLTWSVASANPLDGALIMLFFG
LGTLPALLSVGVAAKSLMGWLQRRAVRWLSGALLIAFGIQTLYIGVAQLG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggactacagcctttcaggcgcctttttggtcggattgatgggcggagttcactgcttt
ggcatgtgtggcggcctgttgggtgccttttccagccaaatcccagcgccgccccgtcat
gaaaaccccctcgcccatcggctcggcttccttttgtcttacaatagcggccgtatcgcc
agctacactctcgctggcgccatcgccggtggtgcctcaggcggcttaagcctgctgttt
gatgcgggccatcttacgctgtttctgcgttttctggccggactcatgatgattcttctg
gggttatacgttgccaaaatctggtctggtgttgtgttcatcgaaacgctcggcaaagga
ctgtggcgtgtaattcagccttttggaaaacgccttctgcccatagacacccgcgccaaa
gccgttcttgctggcagcgtatggggctggttgccctgcggtttggtgtattccaccctg
acctggtctgtcgccagtgccaatccactggatggtgcccttatcatgctgtttttcggt
ctgggcaccttgcctgcactcctgagtgtgggcgtggcggcaaagtcgctgatggggtgg
ttacaacgccgtgctgttcgctggttatcgggtgcactgctcatagcctttgggattcaa
accttatatattggtgtcgcccagcttggctag

DBGET integrated database retrieval system