KEGG   Shewanella amazonensis: Sama_1807Help
Entry
Sama_1807         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2199962..2200831
Genome map
AA seq 289 aa AA seqDB search
MFTSFAFVTGAFVLFGCDNGRNSDTICKNNPELCEDLHKDSWCRYEKGDLIRQRFILKTT
PNPTGKQIYDQLRFLEVYSKCIELASGVQHKVNVQRTNDRLRAFGISVQNLEELQESTKG
SQDPYLAYYHWSRLDDAKSLAVLIKAEKEGQISDPELLSKLAIYYLKTDAARAKKLYLDV
LGMVDADHLDPDWLLGLATASRTLGDLDGSYLYSRANIALTKQSVNEAQMLALLTGDKTK
AAMLDSEAEQLAKAVSSGNFAGSAIEKRLRAEIDTERAKIEPVAPLAQD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatcatttgcatttgtcaccggtgcttttgtgctttttggctgtgataatggc
cgaaactcagacacgatctgtaaaaataatcctgaactttgcgaagacctgcataaagac
agttggtgccgatatgagaaaggggaccttatccgccagcgtttcatcctgaaaactacc
cccaaccccacaggtaaacaaatttacgaccagctcagatttctcgaggtgtattcaaaa
tgcattgagttggcttcaggggtacaacacaaggttaacgttcagcgcaccaatgacaga
ctacgcgcctttggtataagtgtgcagaacctggaagaattacaggaatccaccaagggc
agccaagatccttacctcgcctactaccactggtcccgactcgacgacgcgaaaagtctt
gccgtgctcatcaaagccgaaaaggaaggacagatttctgatccggagcttttatccaag
ctggcgatttactacctgaagactgacgccgcccgagccaaaaaactgtaccttgatgtg
ctgggcatggtcgatgcagaccatcttgatccggactggttacttgggcttgccacagcc
tcacgcactctcggcgatttagacggcagttacctttactccagggccaacatagcgctg
accaagcaaagcgttaatgaggcgcaaatgctggcgctgctgacgggcgataagaccaag
gcggccatgcttgatagcgaagcagaacagttggccaaagcggtcagttccggaaatttt
gccggtagtgcgattgagaaacgcctgagggccgagatagatacagaacgggcaaaaatc
gagccagtcgctcctttagcacaggattga

DBGET integrated database retrieval system