KEGG   Shewanella amazonensis: Sama_1809Help
Entry
Sama_1809         CDS       T00445                                 

Definition
(GenBank) 2-keto-3-deoxy-phosphogluconate aldolase
  KO
K01625  
2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
saz  Shewanella amazonensis
Pathway
Pentose phosphate pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sama_1809
   00630 Glyoxylate and dicarboxylate metabolism
    Sama_1809
Enzymes [BR:saz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     Sama_1809
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     Sama_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2202354..2202998)
Genome map
AA seq 214 aa AA seqDB search
MSENNWSLQPQDIFKRSPIVPVMVINKLEHAVPLAKALVAGGISVLEVTLRTSCALDAIS
KIAAEVPEALVGAGTILNEEQLRQAVEAGAQFIITPGAYPELLKTAMEGTVPLIPGVASI
SEVMAGMALGYRHFKFFPAEASGGVNALKAFQGPLADIRFCPTGGITPSSYRDYLALKNV
DCIGGSWIAPTDAMEAGDWDRITSLCKEALAGLN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaataactggtctttacaaccacaagatatttttaagcgcagtccgattgtg
cctgttatggtgatcaataagttggagcatgcggtgccgctggcgaaagctctggtagcc
ggtggtatcagcgtactggaggtcacgctgcgcacgtcctgtgcactggatgctatcagt
aaaatcgccgctgaagtaccagaagccctcgtgggtgcaggaaccatactcaacgaagag
caacttcgtcaggcagtagaggctggcgcgcagtttatcatcacccccggtgcgtatcct
gagctccttaaaaccgccatggaaggtacggttccactcattccaggtgttgccagtatt
tctgaagtgatggccggcatggcgcttgggtatcgtcactttaagtttttcccggctgaa
gcctcaggtggcgttaatgccctcaaagccttccaggggccactggccgacattcgtttt
tgcccgaccggcggcatcacaccgtcaagctaccgtgattatctggcgttgaagaacgtg
gattgcattggcggcagctggattgcccccacagatgcaatggaagcaggcgactgggat
aggatcaccagcctgtgtaaagaagcgctggctggcctcaactaa

DBGET integrated database retrieval system