KEGG   Shewanella amazonensis: Sama_1824Help
Entry
Sama_1824         CDS       T00445                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent enzyme, beta subunit
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
saz  Shewanella amazonensis
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sama_1824
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sama_1824
Enzymes [BR:saz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Sama_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2220855..2221925
Genome map
AA seq 356 aa AA seqDB search
MSLPICTNWVANAIGKIEADFQRSADTHLIKLELPMLDGIDIYLKDESTHPTGSLKHRLA
RSLFLYALCNGWIKEGTSVIESSSGSTAVSEAYFARLLGLPFIAVMPKSTAKRKIEQIEF
YGGRCHFVEHSSEIYAESEKLAKELGGHYMDQFTYAERATDWRGNNNIANAIFGQMEREP
HPIPSWIVMSPGTGGTSATIGRYIRYQRLATKLLVVDPQHSVFYDYFKTGDAGITCEKGS
CIEGIGRPRVEPSFIPGVVDEMLKVADVDSIATMYWLEALIGRKTGPSTGTNLYGALKLA
SQMKARGETGSIVTLICDPGERYLDTYYNSDWVSSHIGDITAASTALAAFSESGKL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccccatttgcactaattgggtagccaatgccatcggcaaaattgaagccgac
tttcagcgcagcgccgacacccacctgattaagctcgaattaccgatgctcgacggcatc
gatatctatttaaaagacgaaagcacccaccccaccggtagcctcaaacatcgtctggcc
cgttcattgtttctgtacgcactttgcaatggctggattaaagaaggtacgtcggtcatc
gagtcctcatccggcagcactgcggtgtctgaggcctattttgcccgcctgctcggttta
ccctttattgcggtgatgccaaagagcaccgccaagcgcaaaatcgaacaaattgagttt
tacggcggacgttgccattttgttgaacattccagcgagatttacgccgagtcagagaaa
ctcgccaaagaactgggtggccactacatggatcagttcacctacgccgaacgggccacc
gactggcgcggcaacaacaacattgccaacgctatttttggccagatggagcgcgaaccc
catcccatccccagctggattgtgatgagtcccggcaccggtggcacctcggcgaccata
ggtcgctatatccgctatcagcgcctcgccactaaattgctggtggtcgacccgcagcac
tcggtgttttacgactacttcaaaaccggtgacgccggtattacctgtgaaaaaggcagc
tgtattgaaggcattggtcgccccagggtggagccttcctttattccaggcgtggtggat
gagatgcttaaagtcgcggatgtggactccatcgccaccatgtattggctcgaagcctta
atcggccgtaaaaccggcccctctacaggcactaacctctatggcgcactgaaactggct
tcccaaatgaaggcccgcggcgaaaccggcagtatcgttacgcttatctgcgatccgggc
gaacggtatctggatacctactacaacagcgactgggtaagttcgcacattggcgatatc
acggcagcaagtacggcgcttgccgccttcagtgaaagtggcaagctgtga

DBGET integrated database retrieval system