KEGG   Shewanella amazonensis: Sama_1832Help
Entry
Sama_1832         CDS       T00445                                 

Definition
(GenBank) iron-sulfur cluster-binding protein
  KO
K03615  
electron transport complex protein RnfC
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2230826..2233468
Genome map
AA seq 880 aa AA seqDB search
MLTLLEQLDKGTLWRSPGGIHPPEMKSVSNGTAIATLPLFDEYLVPLPQVGEQAILAVKV
GDTVLKGQMLTQGQGVGYLPVHAPTSGRVKAIESRPSNHASALPILTLALEADGQDKWCE
LQSAALDALTPAQMVKRIQDAGIAGMGGAAFPSHIKLSPASEIELVIVNGVECEPYITAD
DRLMREHADGIVAGIGIVHRILAPKRIIIAIEDNKPEAAEAMQAAVNRSQLPAGLVRVTV
IPTKYPSGGEKQLIQIVTGQEVPSGAIPAQLGILVHNVGTLFAIRDAVIEGKPLIERVVT
VTGNAVTKPGNYWTLIGSKVEDVLRHCDFREAEAQKIIMGGPMMGYTLANTQVPILKGSN
CLLLPNGLEITEMPPEKPCIRCGECAVACPASLLPQQLFWHAKAEEYDKAQSYNLKDCIE
CGCCTYVCPSDIPLVEYYRVAKAAIRQQAEEKASAERAKVRFEARITRLEEEKAAREAKA
KEAAEKRKAAMAGGEKDAIAAALARVQAKKAAQEQNAAPVAASPEGAQASAADPKAGVAA
AIARAKAKKTAQQEAAKSPDTAGSTVTDAASDLSIETTPEQESTPASSEDPKKAAVAAAI
ARAKAKKAAQAANSNTAATDTANGNRQVSSLQEPKVQASAVQPPESQAQEQDPKRAAVAA
AIAKAKAKKSARNTDESGLAVAEPSAPATGEAESAPADDKSARVAAAVAKAKAKKLAASA
SDSPFPEDMAAIPEKNRSEASLVQTDESLPETRGDDKPDNKAARVAAAVAKAKAKAAARR
EEAQPDPAVAEHIQSETSQAADADELETDIQAPEKSTLTDMATAMPPAANQIPEQGVHIA
DSANTAASEVPPTDADTLKKARIAAAVAKAKAKKAAKEHE
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgcttttggaacaattggataaaggtacgctgtggcgctcacccggtggcatt
cacccacccgagatgaaatccgtctccaatggcaccgctatcgccacactgccactgttt
gatgagtacctggtacccctgcctcaggtcggtgaacaggccattctcgccgtaaaagtg
ggagatactgtacttaaagggcagatgctgactcagggccagggagttggctatctaccg
gtacatgcccccacctcaggccgcgtcaaagccattgaatcacgcccgagcaaccatgcc
tctgcgctgcccatactgaccctggcattggaagccgatggccaggacaaatggtgtgaa
ctccaaagcgcggctttggatgcgttgacccctgcccaaatggtcaaaaggatacaggat
gccggcatcgccggtatgggcggcgctgcgtttccaagccacattaaattaagtccggcg
agcgaaattgagctggtgatagtcaatggcgttgaatgtgaaccctacattaccgctgac
gatcgccttatgcgcgagcacgccgatgggatagtcgctggtatcggtatagtgcaccgt
atccttgcacccaaacgcattatcatcgccatcgaagacaacaagcccgaagccgctgaa
gccatgcaggctgccgtcaatcgcagccagttaccggcaggacttgtcagggtcactgtt
atcccgaccaaatacccttcaggcggtgaaaagcagctcattcagatagtgactggccag
gaagtgccctccggcgctattcctgcgcagctcggtatcctggtgcacaacgtcggtacc
ctgtttgcaatccgggatgccgtcatcgaaggtaagccactgatagaaagagtcgtcact
gtcaccggcaatgcagtaaccaaacccgggaactactggactttaataggcagcaaggta
gaggatgtcctccgccactgtgattttcgtgaagcagaggcccaaaaaatcatcatgggt
ggccccatgatgggatataccctggccaatacccaggtaccgattttgaaaggcagcaat
tgtctgctgctgcccaacggcctcgaaatcaccgagatgccgcctgaaaaaccctgcatt
cgctgcggcgaatgtgccgttgcctgccctgcgtccttgctgccgcagcaactcttttgg
cacgccaaggcggaagaatacgacaaggcacaaagctataaccttaaagactgtatcgag
tgcggatgttgcacttatgtctgccccagcgatatcccgctggtagagtattatcgggtg
gccaaagccgccattcgccagcaggcggaagaaaaagccagtgctgagcgtgccaaggtg
cgatttgaagcgcgcattacccgccttgaagaagaaaaagcggcccgtgaagccaaggca
aaagaggcggcggaaaaacgtaaagcggccatggccggtggagaaaaagacgccatcgct
gccgccctcgcccgggtacaggccaaaaaagccgcccaggaacaaaatgccgctccggtc
gctgcctcaccagagggggctcaagcttcagcggcggatccaaaagccggggttgctgcc
gccatcgccagagccaaagccaaaaagacagcccaacaggaagcagccaagtcccccgat
acagcgggcagcactgtgaccgatgctgcttcagacctgtctatcgagacgacgcctgag
caggagtcaacgcccgcaagcagtgaagatccgaaaaaggccgctgttgccgcagcgatt
gcccgcgccaaggcaaaaaaggcagcgcaggcggcaaacagcaatacagcggctacagac
accgctaacggtaatcgccaggtatcctccttacaggagccaaaagttcaggcatcagca
gtacagccacctgaatcacaggcgcaggagcaggatcccaagcgagctgctgtggcagcc
gccatcgccaaagcgaaagccaaaaagtctgcccggaatacggatgaaagcggcttggct
gtggcagaaccgtccgcaccagcgaccggggaggcagaatcagccccagcggatgacaaa
tcagcaagagttgccgcagcggttgccaaagccaaggcgaagaagttggcggcaagtgct
tctgacagcccattcccagaggatatggccgctattcctgaaaagaatcgcagtgaggca
agcctcgtacaaacagatgaaagtcttcctgagaccaggggagacgataagcctgacaac
aaagccgccagagtggccgctgcggttgccaaagccaaggcaaaggctgcggccagacgt
gaagaggcacagccggatccagctgtggctgaacacattcaatctgaaacgtctcaagcg
gccgacgccgatgaacttgagactgacattcaggcaccagagaaaagtaccttaaccgac
atggccacggccatgccgcctgcagcaaaccaaataccagagcaaggtgttcacatcgca
gacagcgcaaacactgctgcttcagaggttccaccaaccgatgccgatacgctcaaaaaa
gcccgtattgctgcggctgtcgccaaagccaaggcaaaaaaagccgccaaggagcatgaa
taa

DBGET integrated database retrieval system