KEGG   Shewanella amazonensis: Sama_1838Help
Entry
Sama_1838         CDS       T00445                                 

Definition
(GenBank) TonB-dependent receptor, putative
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2237370..2239889)
Genome map
AA seq 839 aa AA seqDB search
MLKTTRIAWAVNCVLLATSASAVVSSQAFAEEAQAKDVERIAVTGSRIQRQDMETASPVT
VISADAIRAEGFTSVDQMLQAQTSMAGAAVGSSTNNGADGVAQVDLRGMGAERTLVLLNG
RRMVNSGSGADSAVDLNSIPVAMIARVEILKDGASAVYGSDAIAGVVNIITKKDFEGFQF
DFNGSGTDKGDGESGELSMLYGFNTDNGGNYTFGAAYSERRGVIQADRDWTEAGYSSFIP
TGSLEGMVKDANGNWVDRNTGYDFTQDSWYQTPAKRYSLFANMTQELGDDLLLTGDILYT
KRKSDQQMAAQPADIMLGVCGEEGIDAARCITLDGDMIAAGIAPDDTGRVNYRRRTTDVG
PRIYNQDTDTLRASLGLQGSLDINTGMTWDLSYTYGKNKAETWVENSINAVKMENSVYNN
LDSWLSGQPLTQDIINDIGFTERNDGGNEQHVVAGVLSGELFDLSAGAVGFAIGAEYRYD
SGYYNPDPVIVAGEGTAAQQDPTDGNYDVFSIYQEVSVPFTEKLTGEFALRFDDYSTFGK
ASTWKVGLTYEATDDLMLRTVAATGFRAPNVAELFGGNTGSYDYLDDPWGNEQDPQILVN
YTSDPDLKPEESESYTAGLVYSPSYIDGLSLTLDYWRFRVTNAITRLDAQKGLVDCHAGI
LSACETFKITDEGDLSNFTNPLTNVGSQNTSGIDFNLAYNFEALNLDWKINNDLTYLLEF
EQDNVAYEGTSDGNFGGYAKVRNNFSIQAGQADWSLMYYNRFIGETEWLGDRDETVDSVL
YHNVVATYFINDGVTVSLGVKNLTDEEPSYVPNGSDGGTIPEVFDTIGRQIYGGLTMKF
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaccacgagaatcgcctgggcggtcaattgtgttctgttggctaccagtgct
tctgctgtcgtgtccagtcaggcgtttgccgaagaagctcaagccaaagacgtagagcgt
atcgcagtaacaggttcacgtatccagcgccaggatatggaaactgcttctcctgtcaca
gtgatcagtgccgatgccattcgcgctgaaggcttcacctctgttgaccaaatgctgcag
gctcaaacctccatggcgggtgccgctgtgggttcaagcaccaacaacggtgcagatggt
gtagcgcaggttgacctgcgtggtatgggcgctgagcgtactctggtactgctgaacggt
cgccgcatggtgaactcaggttcaggcgctgacagcgctgtggatttgaactctatcccg
gttgccatgattgcccgtgtagaaatcctgaaagacggtgcatctgcagtgtatggctct
gacgccatcgccggtgtggtgaacatcatcaccaagaaagattttgaaggcttccagttc
gactttaacggcagcggcaccgacaagggtgacggcgaaagtggcgaactgagcatgctc
tacggtttcaacaccgataacggtggcaactacacctttggtgcggcttactctgagcgc
cgtggtgttatccaggccgatcgtgactggaccgaggcaggttacagctcattcattcct
accggctctctggaaggtatggtgaaagacgccaacggtaattgggttgaccgtaacaca
ggttatgacttcacccaggacagctggtatcagaccccagccaagcgttacagcctgttt
gccaacatgactcaggaactgggtgacgatctgctgctgaccggtgacatcctgtatacc
aagcgtaaatctgatcagcaaatggccgctcagccagccgacatcatgctgggcgtatgt
ggtgaagagggtatcgatgctgcacgttgcatcactctggatggcgacatgattgctgcc
ggtatcgctcctgatgacactggccgtgtaaactaccgtcgccgtaccaccgatgtgggt
ccacgtatctacaatcaggacaccgacactctgcgcgcctctctgggcctgcaaggttct
ctggacatcaacacaggcatgacctgggacctgtcttacacctatggtaagaacaaggcc
gagacctgggttgaaaactctatcaatgccgtgaagatggaaaactccgtctataacaac
ctggactcatggctcagcggtcagcctctgactcaggacatcatcaacgacatcggtttc
accgagcgtaacgatggcggtaacgagcagcacgtggttgccggcgtactgagcggtgaa
ctgtttgatttgagtgcaggtgcagttggttttgcaatcggtgctgaataccgttacgac
agtggctactacaatcctgatcctgtgattgtggccggtgagggtactgcggctcagcaa
gacccaactgatggtaactacgatgtattctccatctatcaggaagtcagcgtgcctttc
accgagaaactgaccggtgaattcgccctgcgtttcgatgactactctaccttcggtaaa
gcctcgacctggaaagtgggtctgacctatgaagccactgacgatctgatgctgcgtacc
gtagctgctaccggtttccgtgcacctaacgttgccgagctgtttggtggtaacacaggt
tcttacgattatctggacgatccatggggtaacgagcaagatcctcaaattctggtgaac
tacacctcagatcctgatctgaagccagaagagtctgagtcttacactgccggtctggtg
tactctccaagctacatcgacggtctgtctctgaccctcgattactggcgtttccgtgtg
accaacgccattacccgtctggatgcccagaagggtctggttgactgtcatgccggtatt
ctgagcgcctgtgaaaccttcaagatcaccgatgaaggcgatctgtcgaacttcaccaac
ccgctgaccaacgtgggtagccagaacaccagtggtatcgacttcaacctggcctacaac
ttcgaagctctgaatctggactggaagatcaataacgatctgacctacctgctggaattc
gaacaggacaacgtagcctacgaaggcaccagcgatggtaacttcggtggttatgccaag
gtgcgcaacaacttcagcatccaggccggtcaggccgactggagcctgatgtactacaac
cgtttcatcggcgaaaccgagtggttgggtgaccgtgatgaaactgtagactcagtgctg
taccacaacgtggttgccacttacttcatcaacgacggcgtgaccgtatctctgggtgtg
aagaacctcactgatgaagagccatcctacgtgcctaacggcagcgacggcggtaccatt
cctgaagtatttgacaccatcggtcgtcaaatctacggtggtctgacgatgaagttctga

DBGET integrated database retrieval system