KEGG   Shewanella amazonensis: Sama_1839Help
Entry
Sama_1839         CDS       T00445                                 

Definition
(GenBank) Holliday junction DNA helicase RuvB
  KO
K03551  
holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
saz  Shewanella amazonensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:saz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sama_1839
Enzymes [BR:saz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sama_1839
DNA repair and recombination proteins [BR:saz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sama_1839
    RecFOR pathway proteins
     Sama_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2240347..2241351)
Genome map
AA seq 334 aa AA seqDB search
MIEADRLIQPQDLGQEDVIDRAMRPKLLDEYTGQDDTRAQLKVFIEAAKKRGEALDHMLI
YGPPGLGKTTLANIVANEMGVNIKSTSGPVLEKAGDLAALLTNLEEGDVLFIDEIHRLSP
VVEEILYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGSLTSPLRARFGIPLR
LEFYNVRDLSSIVARSAKVMDVPMDEGGAEEIARRSRGTPRIANRLLRRVRDFAEVKHDG
AISRAVAQSALDLLDVDSEGFDYMDRKLLLAIIDKFMGGPVGLDNLAAAIGEERETIEDV
LEPFLIQQGFVQRTPRGRIATARAYSHFDLIKPD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagccgaccggcttattcagccccaggatctgggtcaggaagatgtgattgac
cgcgccatgcggccaaaattactcgacgaatacacggggcaggacgatacccgcgcccag
cttaaagtctttattgaggcggctaaaaagcgcggcgaagccctggatcatatgcttatc
tacggcccaccaggcctgggtaaaaccaccctggccaatatcgttgccaacgaaatgggg
gtgaacatcaagtccacctccgggcctgtgctggaaaaggcaggcgatttggcggccctg
ctcaccaatcttgaagaaggtgacgtgctctttatcgatgaaatccaccgcttaagccct
gtggtggaggaaatcctctatccggcgatggaagactatcagctggatatcatgataggt
gaggggcccgctgcacgctctatcaagctggatttgccgccttttaccctggtgggcgca
acaacccgagcaggttcactcacatcaccgctgcgggcccgtttcggcattccgctgcgg
cttgagttttacaatgtccgtgacctgtcatccattgtggcgcgctccgccaaggtgatg
gatgtgcccatggatgaaggtggcgccgaagagattgcccgccgcagccgcggtactccc
cgtatcgccaaccggctgcttcgccgggtgcgggactttgctgaagtgaagcatgatggc
gcaatcagccgtgcggtggctcagtcagcactggatttattggatgtggacagcgaaggc
tttgattacatggaccgcaagctgctgctggcgattatcgacaagtttatgggaggacct
gtgggtctggataaccttgccgccgccatcggtgaggaacgtgaaaccatagaagatgtg
cttgagccatttcttattcagcaggggtttgtgcagcgcacaccaagggggcggattgcc
acggcccgtgcctacagccattttgaccttatcaaaccagattga

DBGET integrated database retrieval system