KEGG   Shewanella amazonensis: Sama_1846Help
Entry
Sama_1846         CDS       T00445                                 

Definition
(GenBank) methyltransferase, putative
  KO
K15257  
tRNA (mo5U34)-methyltransferase [EC:2.1.1.-]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Sama_1846
Transfer RNA biogenesis [BR:saz03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Sama_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2249020..2250012
Genome map
AA seq 330 aa AA seqDB search
MISFSSFYRQIADTQLQHWLESLPAILGEWQRQHKHGNLPKWEKVLAKLHYPAPEFLDLK
DSVTIGDGLQLDSGQTEKLENLLKILQPWRKGPFHVHGIHIDTEWRSDWKWDRVSPHLSP
LTNRTVLDVGCGSGYHMWRMLGAGAKRVVGIDPSALFLCQFEAIKRLIDTELPVHLLPLG
IEELPPLDAFDTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVVDGDKDTVLVPQ
DRYGKMNNVWFLPSIDALKLWLEKCDFTDVRCVNVDVTSLAEQRSTPWMQNESLVDYLDP
KDVNLTVEGYPAPKRATFIAVKNRSPQDAD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtttctcaagcttttatcgccaaatcgccgatactcaattgcaacactggctt
gagtctttgcccgcaattctgggtgaatggcaacgccaacataaacatggaaacctgccc
aaatgggagaaggtgctggcaaagctgcactatccggcccctgagttccttgacttgaaa
gacagcgtgacgattggcgatgggctgcaacttgacagcggacaaaccgagaaactcgaa
aacctgctgaaaatactgcaaccatggcgcaaggggccgttccatgtacatgggattcat
attgataccgagtggcgcagcgactggaaatgggacagggtttccccccacttaagcccg
ctgaccaatcgcacggtattggatgtgggatgtggcagcggctatcacatgtggcgcatg
ctgggtgcgggagccaaacgggtggtgggaatagacccatctgcactgtttctgtgccag
tttgaagccattaagcgcctgatagataccgagctgccagtgcacctattgccactgggc
atagaggaactgccgccgctggatgcgttcgatactgtgttctctatgggcgtgctttat
cacagacgctcccccatcgatcacttgttacaacttagggatcaattgcgaatgggtggt
gaacttgtgttggaaaccctggtggtagatggtgataaagacacggttctggtgccccaa
gatagatatggcaagatgaataatgtatggtttttaccatcaattgatgcacttaagctg
tggcttgagaaatgtgactttaccgatgtgcgctgtgtgaatgtggatgtcacctccctt
gcggagcagcgcagtaccccatggatgcaaaatgaatcgcttgtggattacctggatccc
aaggacgtcaatcttacagtagagggatatccggcacccaagcgggccaccttcattgcg
gtaaagaaccgcagtccacaggatgcagactga

DBGET integrated database retrieval system