KEGG   Shewanella amazonensis: Sama_1847Help
Entry
Sama_1847         CDS       T00445                                 

Definition
(GenBank) protein of unknown function DUF785
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2250047..2250766
Genome map
AA seq 239 aa AA seqDB search
MFKHTLAVAIIAVCAGCSTTSKPEVAGPAPLNAQELKANLDNSEARMMAVIDKGNLDTQA
KLSELNSAIAALDKNLATFKQNNQMTAAAVVPVECPPSAIGDKFMLGEVEKVFIDELKAS
FHTRIDTGAESSSLDARNILLFERDGEQWVRFDVMVQGESKPASTYESKVVRFVRIKQEG
DVDDRRPVIHAHLKIGKYSAETDLNLTDRSHLDYPLLLGRKFIKDIAVVDVSQQFIHGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataccctggccgttgccatcatcgccgtatgtgcaggttgcagcactacc
tccaaacccgaagttgcaggccctgccccgctaaatgcccaagagctgaaagccaacctc
gataacagtgaagcgcgcatgatggccgttatcgataagggaaatctggatacacaagcc
aaactttctgaactgaacagcgccatcgcagccctggataaaaacctcgcgacattcaag
caaaataatcaaatgactgcggccgcagtagtacctgtcgaatgtccgcccagtgccatc
ggcgacaagttcatgctgggggaagtcgaaaaagtcttcatcgacgaacttaaagccagc
tttcacacccgcatcgacacgggggctgaaagctcgtcactggatgcccgcaacatcctc
ctgtttgagcgagacggcgaacaatgggtgcgcttcgatgtgatggtacagggagaatcc
aaaccggcctccacctatgagtcaaaagtggtgcgttttgtgcgcattaaacaggaaggc
gatgtggacgaccgtcgtcctgttattcacgcccaccttaaaatcggcaaatacagcgcc
gaaaccgatctgaatctaaccgaccgcagccatctggattatcccttgttgcttggccgt
aaatttatcaaagacattgcagttgtggatgtcagccagcagttcattcacggaaagtaa

DBGET integrated database retrieval system