KEGG   Shewanella amazonensis: Sama_1849Help
Entry
Sama_1849         CDS       T00445                                 

Definition
(GenBank) alpha-L-glutamate ligase-related protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2252297..2253253
Genome map
AA seq 318 aa AA seqDB search
MKFAWPWELRRAGVLNMNKRNIDFIGRYNPRKYYQRVDDKLTTKQLALANDIAVPDLIGV
VQEQHEIAEIPEMVQGRGGFVIKPAKGSGGKGILVITKVENGRYYKPSGNEVTPSEIDRH
VSNILSGLFSLGGKPDVAIVEGLIQFDPVFDGYSYEGVPDIRLIVFKGYPVMGMLRLSTA
ASDGKANLHQGAVGVGIDIATGKGLRAVQFNEPIEFHPDTGKRLMDIQVPNWDTLLTTAS
SAYEMCELGYLGTDMVLDSEKGPLLLELNARPGLAIQIANGKGLLPRLKHVESLGNKFMD
VNDRVAYAKVHFGAHADR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcctggccttgggagcttcgccgcgcgggtgtgctcaatatgaacaagcgc
aatatcgactttatcggtcgatataacccgcgaaaatactatcagcgggtggatgacaaa
ctgaccaccaagcagctggcccttgccaacgacatcgcagtaccggatttgattggtgtg
gtgcaggagcagcacgagattgccgaaatcccggaaatggtacaggggcgcggcggcttt
gtgattaagcccgccaagggctccgggggcaaagggattttggtgatcaccaaggtcgaa
aacggtcgctactacaaacccagtggcaatgaagtcacacccagcgaaatcgaccgccat
gtctccaatatcttaagtggcctcttctctcttggcggcaaacccgatgtcgccattgta
gaagggcttattcagtttgatcccgtattcgatggctacagctatgaaggggtaccggat
atccgtttgattgtgttcaagggatatcctgtaatgggcatgttgcgcctgtctaccgca
gcgtccgatggcaaggctaacctgcaccagggcgcggtgggggttggcattgatatcgcc
acaggtaaaggcctcagagcagtgcagtttaacgagcctatcgagtttcaccccgacaca
ggcaagcgcctgatggacattcaggtgccaaattgggataccctgctgaccaccgcctcc
agtgcctatgaaatgtgtgagcttggttatcttggtaccgatatggtgctggacagcgaa
aaaggccctctgctgctggagctaaacgcccgaccgggtctcgccatacaaatcgccaac
ggcaagggattgctgccaagacttaaacacgtggaatcgctcggcaacaagtttatggat
gtgaatgacagggtggcctatgccaaagtgcatttcggcgctcacgctgaccgctag

DBGET integrated database retrieval system