KEGG   Shewanella amazonensis: Sama_1852Help
Entry
Sama_1852         CDS       T00445                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2256261..2257166
Genome map
AA seq 301 aa AA seqDB search
MFRAKSTLEQWRILQAVVDHGGYAQAATALNKSQSSLNHAVAKLQHQLGVELLEVRGRKA
YLTPRGEVLLRRSRYITQSVMELEQLAGNLERGWEPSLTIAREIIYPMDKLITAINAFLP
NGRGTRVSVIDSVLNGTHELVEENKVDIALCGGNPPKGHLAQPLCVVELILVCHPSNPLA
AELKIQDDKFLAQHLQIVIRDTAAKTNKDIGWLKAEQRWTVSNFHEAKAILCSGSGFCWL
PKELVEKELASGDLVRLYLTGSESRKIPINLVVPSRDDQGPAGEALELLILAQHGISCQR
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttcagagcaaaatccaccctcgagcaatggcgaattctgcaggctgtcgtagaccat
ggcggctatgcgcaggccgccactgccctaaacaagagccaatcttcccttaaccatgcc
gttgcaaagttacaacatcagctgggggtggagcttttggaggttaggggacgcaaagcc
tacctgactccccgcggggaagtactgctcaggcgcagccgctacatcacccagtcagtc
atggagcttgagcaacttgcaggcaatcttgaacgcggctgggaacccagcctgaccata
gcccgggaaattatctatcccatggataagctcatcacagccatcaacgcttttttaccc
aatggcagaggtacccgggtctctgtgattgattcggtgctcaatggcacccatgagttg
gtggaagaaaacaaggttgatattgcgctctgcggcggcaatcccccaaagggacatttg
gcacagccactgtgcgtcgtcgaattgattttagtgtgtcacccttccaacccacttgcc
gccgagctcaagatccaggacgacaagtttctcgcccagcatctgcaaatcgttattcgt
gataccgccgccaaaaccaataaggatatcggctggcttaaagctgagcagcgatggacg
gtgagtaatttccacgaagcgaaagccattctgtgttcgggtagcggcttttgctggctg
ccaaaagagttggttgaaaaagagttggcgtcaggagacttggtcagactgtatctgacc
ggaagtgaaagccggaagatccccattaatctggttgtccctagcagagacgatcagggg
cctgcgggtgaggcgttggagctgctcattcttgcccagcatggtatctcatgccagcgc
cagtag

DBGET integrated database retrieval system