KEGG   Shewanella amazonensis: Sama_1857Help
Entry
Sama_1857         CDS       T00445                                 

Definition
(GenBank) thiamine biosynthesis protein ThiS
  KO
K03154  
sulfur carrier protein
Organism
saz  Shewanella amazonensis
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:saz00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Sama_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2261234..2261437)
Genome map
AA seq 67 aa AA seqDB search
MLSISVNGHSHPIDDGQDLASLVKHHCERDSHIALVLNGEVVPRHSWEHIHLKHNDAVEL
FAAVAGG
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtatcagtgttaacggacattcccatccaatagacgacggccaggatctggcc
agtttggttaaacatcactgcgagcgcgatagccatatcgcgctggtgctcaacggtgaa
gtagtaccgcggcatagctgggaacatattcatcttaaacacaatgatgcggttgaactt
tttgcagcagtggcaggaggctga

DBGET integrated database retrieval system