KEGG   Shewanella amazonensis: Sama_1861Help
Entry
Sama_1861         CDS       T00445                                 

Definition
(GenBank) hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM00067
JGI: Sama1861
UniProt: A1S6R0
Position
complement(2266129..2267208)
Genome map
AA seq 359 aa AA seqDB search
MTPLLSTRIPQELPLPLFVTSIWPCLDADNLTNSLDLGGAEHANSSTLVPALTAYTSLEA
GERPGTVKQVDAVKQGAAEARDGTKEPQALPIKLLLSVTLVHLAVLGLLAWQLAPHLGSL
STALDGRANKPKALQSYLVFSAPKQVTEQPSEANPSEPTATNPQPEQLERELVNKQKAPL
EPVLATAPKEPAPIKDEPLPAQPSVEPAQEARWESLPPIETPTLPEHSQLDFSTPASRFM
ARQNEQALTALSERYASDKTAHFGASGRSMSELLPEMEVLLVPSADDFYKPNTLDSKIDP
NRIVKSGDTCYRVVKVPTPLNPHAENLGFPFRCGEDKVKKALKEGINKYLALMGKRDLR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgacgccactgctctctacccgaatcccgcaggaattaccactgccgctctttgttacc
tctatctggccctgtcttgacgccgataatcttaccaatagccttgatctcggaggtgct
gaacatgccaacagctcaacgctggttccagcgttaacggcctatacgtcactggaagca
ggggagcggccaggcaccgtaaaacaagttgacgctgtaaaacaaggtgcagccgaagcg
cgagatggaaccaaagaaccacaggcactgccgattaagttgttgctgtccgttaccctg
gtgcacctggcggtattggggctgctcgcctggcaattggcaccgcacctgggttcgtta
agtacggcactggacgggcgagccaataagcccaaggcgttgcaatcctatttggttttc
agcgcgccaaagcaggtgactgaacagccatcagaagcaaatccttcagagcccacagcc
accaacccccaacccgaacagcttgagcgtgagcttgtgaacaagcaaaaagcgcctctc
gagccagtcttggctacagcgccaaaagagcctgcccctatcaaagatgaaccgctccca
gcacagccttcggttgaaccggcgcaggaggctcggtgggaatcactgccgccaatagag
acgcccacactacctgagcacagccagcttgatttctcgactcccgccagtcgctttatg
gcgcggcaaaatgaacaggcgctcacggctctgtctgagcgttatgccagtgataaaacg
gctcactttggcgcatcgggtcgcagtatgtcggagttgttgcccgagatggaggtactg
ttggtaccgagcgccgatgatttctataaacccaatacccttgattcgaaaatcgatccc
aaccgtatcgtcaaatcaggcgatacctgttatcgggtggtcaaggtgccaacgccgttg
aatccgcacgccgaaaacctgggattcccatttcgctgtggtgaagacaaggtgaaaaag
gcgctgaaggaaggcatcaataagtaccttgccttgatgggcaagcgagatttgcgttga

DBGET integrated database retrieval system