KEGG   Shewanella amazonensis: Sama_1868Help
Entry
Sama_1868         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2276852..2277583
Genome map
AA seq 243 aa AA seqDB search
MRKFLLSLALPLLSINAYAQNSLSPFEADYKVLYGDIGLGKAHFSLPAPEGNYYEYNFTS
ELSLLFLSDERSIKSKFRRTDHGLEPMVFIHQRTGTGSDFSEQVAFLKDKSIVRSNYKGE
HVELPFENKLYDTMMVQLQFRQDLIEGKDSLEYHMVKDNEIDDYSFKRMGEEVLNIDGTE
YRTLRLEVIRDSKKRKTVVWMAPDLAYLPVRMTHFEKGDKQLDVQLTGYRFSDTQAAPLA
ANP
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagtttctgttatcccttgccctgccactgttgagtattaatgcgtatgcacaa
aactcactgtcgccctttgaggccgactacaaggtgctgtacggcgatattggcctgggc
aaggcccatttcagcctgccggcacccgagggcaactattacgaatacaattttaccagc
gagctgagtttgctgtttttaagcgatgagcgcagtatcaagagtaaattccgccgcacc
gaccacggcctcgagcccatggtgtttatccatcagcgcacgggtaccggcagtgatttc
agcgagcaggtggcctttttgaaagacaagtccatcgtgcgcagcaactacaagggtgag
catgttgaactgccgtttgagaacaagctctacgacaccatgatggtgcagttgcagttc
cgtcaggatctgattgaaggcaaagacagcctcgaataccacatggtgaaagacaacgag
attgatgattactccttcaaacgcatgggtgaagaagtgctgaatatcgatggcaccgag
taccgtaccctgcgccttgaagtcattcgcgacagcaaaaaacgtaaaaccgtggtgtgg
atggccccggatttggcctacctgccggtacgcatgactcactttgaaaaaggcgacaag
cagctggatgtacagctgaccggttatcgtttttccgacacccaggccgcaccgctggca
gccaacccttaa

DBGET integrated database retrieval system