KEGG   Shewanella amazonensis: Sama_1872Help
Entry
Sama_1872         CDS       T00445                                 

Definition
(GenBank) sensor histidine kinase
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Reg_prop HisKA_3 HATPase_c SGL HATPase_c_2 Y_Y_Y DUF4381 dCache_1
Motif
Other DBs
NCBI-ProteinID: ABM00078
JGI: Sama1872
UniProt: A1S6S1
Position
2283634..2286774
Genome map
AA seq 1046 aa AA seqDB search
MSAVIRTIIYLMLLHFGNAWSAPEKIAQNVDFDSDNISAILIDKQGFMWLGTQDGLFFYD
SYQLEKFRPDADTPGTIAALDIRNLYLSRDNSLWISTNSGGLSRFNPDTRTFTNYRHNSE
DINSLSNDSVYDVADGPDGELWVATQIGLNRLNPATGQVRRYLKDDTNAASLPSNYVYTL
FVDSSNRLWIGTIGGGLAYWAGETQGFISLELPNVITDVFSIVEQDGKYLWVGTRQGLLR
ITLDNLLVRRIQPDQGNEPELMIISLHLDANQLVLGTFGQGLKFYNTDTNQLSHASQDIP
GAKDTITSMVKDSTGQLFYATWGRGAYKLDVTERNKSDDGTAKRTSLSLPNVAAMYAKSG
SNKAWVGSFSDGLHWLDLDTQRLNRFTPSTSANNINGVLSIASFGADELLVGTSEGLWHL
IGNGTVKAHFSHQPEETGSIGKGFVRVLQPDDSGDVWVGIGGDGLYKYHPDSGTFSSYTH
DPSVPDSLSGNYITSLLIDGPYLWVGTRSNGLNLCQKDSMSCQRLQVHNSGLNHFYISDI
AKDDLGNIWVGTDGGGLHKAEFHRTGVKTEVRITPEPGLAADSIKSILPGASGEVWFTTS
DGLFSYHSNQKRFHKATDRVLNGLGGFSQRSRASTGEFNLLGTNNGVYLFSSISNVEPET
QFPVRFTQIVSDSLANPILNTAIQDPFQMSVPWGGWLNVEFALLDFGSSAHSYQYRMSSE
SQWISLNNMHHLNFYKLDPGVHRLEVRGRGINQAWSQPATLHLTVIPPWWRNTTYIGLLL
VCIALVAVSYHRFRMARWERYTRHLNALKEEKLAVIEKLRQNEQHLKSAFEGMRNLATRL
QYAKEEERKSISRELHDQFGQSLTATQISLQLFRRQHPGDPKLIDTCITTIQAMIKQVRA
ISFDLRPSLLDDVGLVAGLHHQLNKMSSSLTHPIIFNADTDIPELSPELTITLFRVIQES
VTNAIRHANATRIEVKLYPDGDKIKAEVSDNGVGFEPGGISAKVSKGGHLGLLGIEERVK
SQNGNLNIKAIPHGGVSISVEFPYEK
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggtaataagaactatcatttatctaatgcttttgcactttggtaacgcctgg
tccgcacctgaaaaaattgcacaaaacgtagactttgactcagacaacatttccgcaatc
ctgattgataaacaaggttttatgtggcttggaacccaagatgggttgttcttttacgat
agctatcaactggagaaattcaggccggatgctgatacgccgggcaccatcgcagctttg
gatatacgcaatctctatctgagtcgggacaacagtctctggatatccactaacagcggt
ggcctcagtcgattcaacccggacacccgcactttcactaattaccgccacaattccgaa
gatattaattccctgtccaatgacagtgtttatgacgtcgctgacggccctgacggtgag
ctttgggtagcgactcagattggattaaaccgattaaatccggcaaccggacaagtgcgc
cggtaccttaaagacgacacaaacgccgcgtccctgccctcaaactatgtttacacgctt
tttgtcgacagcagcaaccggctttggattggaaccattggcggtggactggcgtattgg
gcaggtgaaacccaaggattcatcagtttagaactgcccaatgtgataacggatgtattt
tccatcgtcgaacaggatggaaaatatttgtgggtcggcacccgccaggggttgctcagg
ataacgctggacaacctactcgtcagacgtatccagccagatcagggcaatgagccggaa
ttgatgattatttcattacatctggacgccaatcagctggttttaggtacctttggccaa
ggcctcaagttttacaacactgataccaatcagctcagtcatgctagccaggatatccca
ggcgccaaagacaccattaccagcatggtaaaagacagcaccgggcagcttttttatgcc
acctggggacgaggagcctataagctggatgtgaccgagcgaaataaatcggatgacggt
acagccaagcgcacgtcactctctttgcctaatgtcgcagcgatgtacgcaaaatccggc
agtaataaagcctgggttggctctttcagtgatggcctgcactggcttgatctcgacacc
caacgactgaatagattcacccccagtacatcagccaataacattaatggcgtgctgagc
attgcttcctttggagcggacgagctactggttggaacatcggaaggcttatggcatctg
attggcaatggcacggtgaaagcgcatttttctcaccagcctgaagagacgggctcaatt
ggcaagggctttgttagagtgctgcaacccgatgacagtggcgatgtctgggtcggcatc
ggaggtgatggcctatacaaataccatcccgacagcggaacattcagttcatatacgcac
gacccttcagtaccggattccctgagtggaaattacatcacctcacttctgatagatggt
ccttacctttgggtgggcacccgctcaaatggcttgaatctctgccagaaagacagcatg
tcctgtcagcgtcttcaggtacataacagtgggttaaaccacttttacatctccgatatc
gcaaaggacgacctgggtaatatttgggttggtaccgatggcggcggtttacacaaggct
gaattccaccggactggtgtcaagacagaagttcgtatcacgccagagccgggattggct
gcagactcgattaaatccattttaccgggagcatcaggcgaagtttggtttacaacaagt
gatggactattcagctatcactcaaaccaaaagcgctttcacaaggcaacagacagggta
ctgaacggcctgggtggattttcgcaacgttctcgagcaagcactggcgagttcaacctg
cttggcaccaataatggtgtgtatctcttttcgtcgatatccaacgtcgagcccgagacc
caattccctgtccgattcactcagattgtatctgatagcctggcaaacccaattttaaac
actgcaattcaagaccctttccaaatgtcggtcccctggggtggctggctgaatgtggag
tttgccctgctggactttggctcatcggctcatagctatcaatatcgcatgtcttctgag
agccaatggatatcgctgaataacatgcaccatttgaatttctataagctcgatccaggt
gtacaccgtcttgaagtgcggggaagaggcataaaccaggcatggagccaaccggcaaca
ctgcacctcacagtgatccccccctggtggcgaaataccacctacatcggcttattactg
gtgtgcatcgcattagtggcggtgagttatcacaggtttcggatggcaagatgggaaaga
tatacccgtcatctcaatgcgctgaaagaagagaagctcgctgtgattgaaaagctcagg
caaaacgaacaacatctgaaatccgcgtttgaaggaatgcgtaatctggccacccgcctg
caatatgccaaggaagaagagcgtaaatccatttcccgggaacttcatgatcaattcggt
caatcactcactgccactcagataagcctgcaactgttccggcgccaacaccccggtgac
ccgaaactgatagatacctgtattacgactatccaggccatgattaagcaggtacgcgca
atctcgttcgatttacgtcccagtcttctggacgacgttggtttggttgcaggtcttcac
caccagctcaataagatgtcatcgtcattgacgcaccccattatctttaatgcagacaca
gatatacctgaacttagccccgagctgaccattactctattcagggtaattcaggagtca
gtcaccaatgccattcgccatgcaaatgccacgcgaattgaagtaaagctttacccagac
ggtgacaagatcaaggccgaggtttctgataacggcgttggcttcgaacccggtggcatt
tccgctaaagtcagcaaaggtggccatttgggcctattgggtattgaggagcgggtaaag
tcccaaaacggtaatttgaatatcaaagccattccccatggcggagtctccatttcagtt
gagtttccttatgaaaagtaa

DBGET integrated database retrieval system