KEGG   Shewanella amazonensis: Sama_1886Help
Entry
Sama_1886         CDS       T00445                                 

Definition
(GenBank) hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2302018..2302545)
Genome map
AA seq 175 aa AA seqDB search
MKLPLLMLSLLLGAGCAEAVVTPVTEDTNLRQQQNGFKENTMDMPLIGALTVEGTDKRGK
LLVTLTVTHQGSSVITAHFTSGMGADLWLMDKGHRKVWAWSQEMMFTQALRQTQIAPGEV
LTHKFAVPQQALSSCQGPCQFEAIFAGTTEGRSPLMAPVSMNVSGLAVPVIPPRS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccactgctgatgctaagtttgctgctcggcgctggttgcgccgaggcggtt
gtaacgcctgtgacggaggataccaacttacgtcaacagcaaaacggatttaaggaaaac
accatggacatgccacttattggagccctgacagtagaaggcactgacaaacgtggcaaa
cttttggttacgctcactgtcactcaccagggcagcagtgtgattaccgcgcacttcacc
tcaggaatgggcgcggatctctggcttatggataaggggcatcgcaaggtatgggcctgg
tcgcaggaaatgatgtttactcaggcattgagacaaacccaaatcgcccccggtgaggtg
ctgacgcataagtttgctgtgcctcaacaagcgctgtcgagctgtcagggaccctgccag
tttgaggcaatctttgctggcaccacggaggggcgaagcccattgatggcccctgtcagc
atgaatgtatccgggttggcggtgccagtcatcccccctcgcagctga

DBGET integrated database retrieval system