KEGG   Shewanella amazonensis: Sama_1898Help
Entry
Sama_1898         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2315386..2316414
Genome map
AA seq 342 aa AA seqDB search
MARGISVRLEPFLARRLPPAREQTLSHKGIFILPSGFGLAWLVLTTLLYLLGTNYQNNLI
IGISLLLVSLFVSCIIYSYRNLEGLTLKRLTLPPIYAGETLAMPLQLSTQRDAHQIALAY
PDINPVYASANTTPNEVLIPIPTEKRGILSPGRLKVESRFPLGLMRTWTWVDLDIAHPVF
AAHRQDTLIQTPQSDGDTQEQGSLVSGMDEYQGLKNYIPGESLKQVAWKQLAQGRGMLSK
DFAMPQGAPRWLSLPLQMPEGREHWLSVLSYWVDELSSRQQIFGLSLPGLNIAPSSGDAH
RLACQVAIATFDSAPVTLRTAGSDPEPTPEGPNSRATSHGRI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccaggggcatatctgtcaggcttgagccattccttgccaggcgtttaccgcccgca
cgggagcaaaccctcagccacaaggggatctttattttgcccagtggttttgggcttgcc
tggctggtgttaacgaccttgctgtatctgcttggcaccaattatcaaaacaatctcatc
attggcatcagtcttttgctcgtcagcctcttcgtcagttgcattatctacagctatcgc
aatctcgagggcctgactctgaagcgtttaacgctgccccccatctatgccggcgaaaca
ctcgccatgccattacagctcagtacccaaagagatgctcatcaaatcgcccttgcctat
cccgacatcaatcctgtgtatgcgtcggcaaataccactcctaacgaggtgctgatccct
atccccactgagaagcgtggcatattaagccccggacggctgaaagttgagtcccgcttc
ccgcttgggttaatgcgcacctggacctgggttgatctcgacatcgctcacccggtgttt
gccgcccacagacaggatacccttattcaaacaccacaatcggacggggatacccaagag
caaggctctttggtcagcggcatggatgaatatcaggggctaaagaactacatcccggga
gaatccctcaaacaggtcgcctggaaacaactggcacagggacggggcatgttatccaaa
gattttgccatgcctcagggggcgccccgttggctgagtttgcctcttcagatgcccgaa
ggccgggaacactggctctcggtactgtcttattgggtggatgagttaagcagtcgacaa
cagatctttgggctcagcttacccggattaaacattgccccctcgtccggggatgcccat
cgtctggcctgtcaggtggcaattgccaccttcgattcagccccagtaactctcagaact
gccggaagcgatcctgaaccaacccccgaaggcccgaactcccgcgcaacatcacatgga
aggatataa

DBGET integrated database retrieval system