KEGG   Shewanella amazonensis: Sama_1902Help
Entry
Sama_1902         CDS       T00445                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
saz  Shewanella amazonensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:saz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2325741..2327636
Genome map
AA seq 631 aa AA seqDB search
MIELSGKPCSSDALKAQLKLWQSQGELSALDRHFALQMAELHSDDSPLMLLMCVLVSRQL
SRQHPCLDLSALMLGNPMGTRQAQLRILADYPALLGAVANLDAVGSPDENKPLILEGKRL
YLKRYQGFESRVAARLNAMAGTELSTHAHTAALLEALFPVGKEAIDWQKIAVATAAGKQL
TVITGGPGTGKTTTVTKLLLLLSLSSSLNIRMVAPTGKAAARLSESIKASKQRLTQELNS
PLISQDAIASLPEDASTLHRLLGFQPGNHKFRHHRDNPLDLDLLLVDEASMVDLPMMDRL
LDALPGHARLILLGDQDQLASVEAGAVLADICEGARQGYRYSAVQTARIEGLTGTKLAPR
ADAPGLGDNLCRLLHSHRFAEDAGIGQLAMAVNEGDKEKVAAVWQKNYAELSWIPGDNSD
GLAALVQLAKSAYSEYLQAMKQQAEPKTILQKYNEFRVLCAMKNGEYGVDGINRAITAAL
ARAGLIEPSQEFYAGRPVMIQSNDYSLGLFNGDIGILLPVEGDNQRLMTHFIQSDGQVLK
VLPARLPGHETCYAMTVHKSQGSEFASVALSLPPQPTPSQQSLIGRELIYTAITRAKSKF
TCLGTEALFEAATQRRTERASGLADRLWHED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatagaactttcaggcaagccctgtagcagtgatgccctcaaagcgcagctcaaactg
tggcaatcacagggagagctgtcggcactggatcgccactttgccctgcagatggccgag
cttcacagtgacgattcaccgttgatgctgctgatgtgcgtgttggtgtcacggcagctt
tcccgtcagcatccctgtcttgacttaagcgcattgatgcttggcaacccaatgggcacc
cgtcaggcgcagctgcgcattctggctgattaccctgcactgttgggtgccgttgccaat
ctcgatgccgttggcagcccggatgaaaacaagccactgattttagaaggcaaacgtctc
taccttaagcgctatcaaggctttgagagccgggtcgcggcgcggcttaatgccatggct
ggaactgagctcagtactcatgcccacacggcggcgctgctggaggcgctgttcccggta
ggcaaagaggctatcgactggcaaaaaatcgcggtggccaccgccgcaggaaagcagctg
actgtcatcaccggcggccccggcacgggtaaaaccaccacggtgaccaagttactgctg
ctcttgtcgctgtcatcctcattgaatattcgcatggtggcgcccacgggcaaggccgct
gccagactgtcggagtccatcaaagccagtaagcagcgactgactcaggagttaaactcg
ccccttatctcccaggacgccattgcaagcctgccggaagatgcctcgacccttcaccgt
ctgcttggctttcaacctggcaaccacaaatttcgccatcacagagacaatccgctggat
ttggacttattgctggtggatgaggcctccatggtggatttacccatgatggacaggctg
cttgatgccctgccaggccatgcccggctcattttgctgggcgatcaggatcagctcgct
tcagtggaagccggtgcagtgcttgctgatatttgtgaaggcgcgcgccagggttaccgc
tacagcgcggtacaaaccgcacgcatcgaggggctcacaggcacaaagcttgccccacgc
gcagacgcccccgggcttggcgataacctgtgccgactgctgcatagccacagatttgcc
gaagacgccggtattgggcagctcgccatggcggtaaatgaaggcgacaaagagaaagtc
gctgctgtgtggcaaaaaaactacgcagagctgagctggatcccgggtgataacagtgat
gggctcgcagccttggtgcaactggccaaatccgcctacagcgagtatttacaggcgatg
aaacagcaggccgagcctaaaaccatactgcaaaagtacaatgaatttcgggtactctgc
gccatgaaaaacggcgagtatggcgtggatggtatcaatagggccattaccgcagccctt
gccagagccggactgatagagccaagccaggagttttatgcaggccgcccggtcatgatc
cagagtaacgattacagtctggggctctttaatggcgacattggcatactgcttccggta
gagggggataaccagcgcctgatgacccattttattcaaagcgatggccaggtgcttaaa
gtcctgccggcgagactaccgggacacgagacctgctacgccatgacagtgcacaagagc
cagggcagtgaatttgcctcggtggcactatccttaccgccacagccaaccccatcccaa
cagagcttgattggccgagagctgatttacaccgccattacccgggccaagtcgaagttt
acctgccttgggacagaggctttgtttgaggccgcgacacagcgtcgcaccgagcgggcg
tcggggctggcagaccgcttatggcatgaggattaa

DBGET integrated database retrieval system