KEGG   Shewanella amazonensis: Sama_1904Help
Entry
Sama_1904         CDS       T00445                                 

Definition
(GenBank) AMP-binding family protein
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Sama_1904
Lipid biosynthesis proteins [BR:saz01004]
 Acyl-CoA synthetase
  Unknown
   Sama_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2329003..2330724
Genome map
AA seq 573 aa AA seqDB search
MHMPSDHTAPNPLPLTQSHYLGSDAPELIQDTIGRYLECIANRYPDHEAIVMHHQNIRWS
YRQYLTEIDRLATGLLALGIGPGDRVGIWSPNNIEWCLTQFATARIGAIMVCINPAYRPE
ELEYALVNVGCKALITHDKFKSSDYLAMLQSLAPELAHCEAGQLQSSRLPDLKLVIRTGS
EATPGMLNFDKVCSLGSDAEYADLQGISEKLSPFDPINIQFTSGTTGNPKGATLSHHNIL
NNGMLVAKGMRFSHLDRLCIPVPLYHCFGMVLGNLVCVATGATAVFPGDAFDPATTLAVV
EKEHCTALHGVPTMFIAELELANFNDYDLSSLRTGVMAGATCPEEVMKRVQTLMHMQEVV
IGYGQTECSPINNLTEIDSSLELRVTTVGRALAHTEVKIVDVFGKTQPIGEPGDVCSRGY
CVMLGYWNDDAKTRDTIDSEGWLHSGDLGVMDEHGYVRIVGRIKDMIIRGGENIYPREIE
EKLFTHPQVQDAAVFGVQSDKYGEEVCAWIKLRPGANLDEQEIRHFLTEKVAYFKVPRYI
KFVESYPMTVTGKLQKFRMRELMYEELYQDINR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgccctcagaccacacagcgcccaaccctcttccacttacccagagccattat
ctcggcagcgatgcccctgagctgattcaggacaccataggccgctaccttgaatgcatt
gccaaccgctatccagatcacgaagccattgtcatgcatcatcagaacatccgctggagc
tatcgacagtatctgaccgaaatcgaccgattggctacaggccttttagcgctggggata
ggtcccggtgatagggtcggtatttggtcacccaacaatattgaatggtgtttgacccaa
ttcgccaccgcccgcatcggcgccatcatggtgtgtattaatcccgcttaccgccccgaa
gagctggagtacgcgctggtcaatgtgggctgcaaggcccttatcacccacgacaaattt
aaaagcagtgattacctggcgatgttgcaatcgctggcgccggagctggctcactgtgaa
gcaggacagctgcaatcgagccgcttaccggaccttaaattggtgatccgtaccggcagt
gaggcaacgccgggcatgctgaactttgataaggtgtgtagcctcggaagcgatgccgaa
tatgctgaccttcaagggataagcgaaaaactctcccctttcgatcccatcaatatccag
tttacgtcgggcaccacgggtaaccccaagggcgcgaccctgtctcaccacaatatcctc
aataacggcatgttggtggcaaagggaatgcgcttcagtcatctggacaggctttgcatt
ccggtgccgctctatcactgctttggtatggtgctgggtaatctggtgtgtgtcgccaca
ggtgccacggccgtttttcccggcgatgcctttgacccagccactacacttgccgtcgtc
gaaaaagagcactgcacggcactgcacggcgtgcccaccatgtttattgccgagttggag
ctcgccaacttcaacgattacgatctctcaagcctgcgcaccggcgttatggccggcgcc
acctgccccgaggaagtgatgaaacgggtacagaccctgatgcacatgcaggaggtggtg
ataggttatggtcaaaccgaatgcagccccatcaacaacctcaccgaaatcgactcttca
ttggagctcagagtcaccaccgtgggccgggcgctcgcccacaccgaagtaaaaatcgtc
gatgtgtttggcaaaacccaacccattggtgagccgggcgatgtatgcagccggggttat
tgtgtgatgctgggatattggaatgacgatgccaaaacccgcgataccatagacagcgag
ggttggctgcattcaggtgaccttggcgtgatggatgagcacggttatgtacgcattgtc
gggcggataaaggacatgatcatccgcggcggcgagaacatctatccccgggaaatcgaa
gagaagctctttacccatccacaggtgcaggacgccgccgtattcggggtgcagagcgat
aagtatggcgaagaggtttgtgcctggataaagctgcgcccgggcgccaacctggacgag
caggaaatccgccacttcctcaccgaaaaagtggcctacttcaaggtgccaaggtacatc
aagtttgttgagagctatccgatgacagtgaccggcaaactgcaaaaattccgcatgcgc
gaattgatgtacgaagagctttatcaggatatcaatcgctaa

DBGET integrated database retrieval system