KEGG   Shewanella amazonensis: Sama_2001Help
Entry
Sama_2001         CDS       T00445                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sama_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2430742..2431785
Genome map
AA seq 347 aa AA seqDB search
MGEKPPATADLLQTAAGRLKKAVPLMLKHQIPTTPINYALWYTYVGEQQPELNKALDDLV
AQYHTLPPVSGELLYREHLADPVELDVRDMRQNLEAMATELGNQLKDTNLDATAFQQKID
ANFSRLERIDNESLSLEQVLNLVRTLVKESDAIRESTSYFTGQLAKAQQEIDTLKRRLAE
SEKDVFFDALTGCLNRRAFDADLAGLLALAPEGCCLILCDIDHFKHFNDNYGHQLGDQVL
KLVGKRLTEACRDGVKCYRYGGEEFALLVPSSNLRIARQLAEGIRRGVEKLTLKDRRRDA
RIDNISASFGVAQWQPKMTARNLIEHSDKQLYEAKRLGRNRVMPISG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaaagccaccagccaccgctgatctcttacaaacagctgccgggcggttgaaa
aaagccgttcctttgatgcttaaacatcaaatccccaccactccgataaactatgccctc
tggtacacctatgtgggcgagcaacaacccgagctcaacaaagccctggacgacctggtg
gcccagtaccacacactgccaccagtcagcggcgagctcttgtatcgcgaacatctggcc
gatccggttgagcttgatgtgcgggatatgcgccagaatctcgaggccatggccaccgag
cttggcaaccagctgaaagacaccaacctggatgccaccgcatttcagcaaaaaatcgac
gctaacttttcacgattggaacgcatagacaacgagagcctgagtcttgaacaggtgctg
aatctggtgcgtaccctagttaaagaatccgacgccatccgcgagtccaccagctacttc
accggccagctcgccaaggcgcagcaggaaatcgatacactcaaacgccggctggccgaa
agtgaaaaagatgtgtttttcgatgcactcacgggctgtctcaatcgccgtgcctttgat
gccgaccttgctggtctgctggcactggcacctgagggttgttgccttatcctgtgtgat
atcgaccatttcaagcactttaacgataactatggccaccaacttggcgatcaggtactg
aagctggtgggcaaacgcctaaccgaagcctgccgggacggcgtgaagtgctaccgttac
ggcggtgaggagtttgccctgctggtcccatcaagcaatctgcgcatcgcgcgccagttg
gcggaaggcattcgccgcggcgtagaaaagctgaccctcaaggacagacgcagggatgcc
cgtatcgacaacatcagcgcgtcgttcggtgtggcccagtggcaacccaaaatgaccgca
agaaacctgattgagcactccgacaagcagctttacgaagccaaacgccttggacgcaac
agagtcatgcctatctcaggctga

DBGET integrated database retrieval system