KEGG   Shewanella amazonensis: Sama_2079Help
Entry
Sama_2079         CDS       T00445                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
saz  Shewanella amazonensis
Pathway
saz00010  Glycolysis / Gluconeogenesis
saz00620  Pyruvate metabolism
saz00640  Propanoate metabolism
saz00680  Methane metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sama_2079
   00620 Pyruvate metabolism
    Sama_2079
   00640 Propanoate metabolism
    Sama_2079
  Energy metabolism
   00680 Methane metabolism
    Sama_2079
Enzymes [BR:saz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sama_2079
Lipid biosynthesis proteins [BR:saz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sama_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABM00285
JGI: Sama2079
UniProt: A1S7C8
Position
2520358..2522310
Genome map
AA seq 650 aa AA seqDB search
MSTQSLYSVPADIAANALVNNEQYQKMYQESVANPEGFWGEHAKRIDWIKPFTQVKDTSY
DDQNLYIKWFHDGTLNASANCLDRHLASKGDDVAIIWEGDDASEQRKVTYRELHAEVCQF
ANALKAEGVKRGDVVTIYMPMVVEATVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KLLITADEGVRGGRKIPLKGNIDEALNRPDVTTVETVIVLKRTGGAVNWVEGRDKWWHQV
TDGAATECAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYASMTHEYVFDYKPGEV
YWCTADVGWITGHSYMVYGPLANGATILIHEGIPNFPSPARLGEIVDRHQVNILYTAPTL
IRALMAEGKQHFDNFDGKSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNEGNILEGATEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHD
LVAEAAVVGYPHDIKGQGIYAYVTLTKGTEATEELRQELRQWVRKEIGALATPDLIQWAS
GLPKTRSGKIMRRFLRKIAANEITNLGDASTLADPSVIDTLIESRLNRAD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtctctctactcagtgcccgccgatatcgccgccaatgcactggtaaac
aacgaacaatatcaaaagatgtaccaggaatccgttgccaatcccgagggtttttgggga
gagcatgccaagcgcatcgattggattaaacctttcacccaggtcaaagacacttcctac
gatgaccagaacctgtatatcaaatggttccatgacggcacactcaatgcgtcggccaac
tgtcttgatcgccatctggcctccaagggtgacgatgtcgccatcatttgggaaggcgat
gatgccagcgagcagcgcaaagtcacctatcgtgaactgcacgccgaggtgtgtcagttt
gccaatgccctcaaggctgaaggtgtaaagcgcggtgatgttgtcaccatttatatgccc
atggtggtcgaagcgaccgtcgccatgctggcctgtgcccgcataggtgctgtgcattcg
gttgtgttcggtggtttctcaccagactccatcgcatcccgcgtcattgacggtaaatcc
aaactgctgattaccgccgacgaaggcgtgcgtggtggccgtaaaattccgcttaaaggg
aatatcgatgaggcgctgaatcgtcccgatgtgaccacagtagaaaccgttatcgtgctc
aaacgcaccggcggcgcggtaaactgggtcgaaggccgcgataaatggtggcatcaggta
actgacggtgccgcaaccgagtgtgccgttgaggaaatgggggccgaagacccgctgttt
ttgctgtatacctcaggctctaccggtaatccaaaaggcgtgctgcacaccacaggtggt
tacctcgtttacgcctctatgacccacgaatatgtgtttgattacaaacccggtgaagtg
tactggtgtaccgccgacgtgggctggatcaccggccacagctacatggtctacgggcca
ctggccaacggtgccaccatccttatccatgagggtatccccaacttcccaagcccggca
cgcctgggtgaaatcgtggaccgtcatcaggtcaatatcctgtacacagcccctaccctt
atccgtgcgctcatggccgaaggcaagcagcactttgataatttcgatggcaaatcgctg
cgtatcatgggctcggtgggtgaacccatcaacccagaagcctggcgctggtaccacgaa
gtcattggccatgaacattgcccaatcgtggatacctggtggcaaaccgaaaccggcggc
atcctgatcacgccgctgccgggtgccaccgacaccaagccgggctctgctacccgcccc
ttctttggtgtgcagccagcgctggtggacaacgaaggtaatattctcgaaggcgccacc
gaaggcaacctggtgctgctggactcctggcccggacagatgcgtaccgtatacggcgat
cacgagcgctttgtgctgacctatttcaagaccttccgcggcatgtacttcaccggtgac
ggtgcccgtcgtgatgaggacggttactactggatcaccggtcgtgtggatgacgtgatt
aacgtgtccggccaccgcctcggcacagctgaagtggaaagtgccctggtagcacatgac
ctggttgccgaagccgctgtagtgggttacccccatgacatcaagggacagggtatttat
gcctatgtcaccctgaccaagggcaccgaagcgacagaagaactgcgtcaggaactgcgt
cagtgggtacgtaaagaaatcggcgccctggcaacccccgatttgatccagtgggccagc
ggcttgcccaagacccgctccggtaaaatcatgcgccgcttcctgcgcaagattgcggca
aacgaaatcaccaacctgggtgatgcttccaccctggccgacccatcggttatcgatacc
cttatcgaaagccgcttgaatcgcgccgactaa

DBGET integrated database retrieval system